PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc00378.1.g00170.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family bZIP
Protein Properties Length: 281aa    MW: 30446.9 Da    PI: 4.995
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc00378.1.g00170.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_136.21.4e-11177235563
                                     CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                          bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                                     kr++r   NR +A rs +RK  +i+eLe+kv++L++e ++L  ++++l+   + l+se+
  Zmw_sc00378.1.g00170.1.sm.mkhc 177 KRAKRILANRQSAARSKERKMRYIAELERKVQTLQTEATTLSAQMSMLQRDTSGLTSEK 235
                                     9***********************************************99998888875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.6E-15173237IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.99175238IPR004827Basic-leucine zipper domain
PfamPF001701.6E-9177234IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.6E-11177228No hitNo description
Gene3DG3DSA:1.20.5.1708.8E-12177232No hitNo description
CDDcd147032.25E-22178227No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 281 aa     Download sequence    Send to blast
MDQTPIVEPA AAASASTSSA AEAAASRDVA AMLPNSPLRR GAGHRRAQSE ILLGGALPDD  60
LTFDADLGVV GEAGRDEYEE DDDDDDEECV GRSSRMFEMF LENNGGLTEP TEPSPHPHQQ  120
APPAAPTARP RHQYSMSMDG STSLGYSSAG MAGRSGADAK KAISDAKLAE LALVDPKRAK  180
RILANRQSAA RSKERKMRYI AELERKVQTL QTEATTLSAQ MSMLQRDTSG LTSEKSDLKM  240
RVQTMEQQVR LQDALNDRLR DEIQQLKIAT GQTRYRLGAG D
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription factor with an activatory role.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001353704.11e-124uncharacterized protein LOC100382174
SwissprotQ040885e-75POF21_ARATH; Probable transcription factor PosF21
TrEMBLC0PDU91e-122C0PDU9_MAIZE; BZIP transcription factor
STRINGGRMZM2G112483_P011e-123(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP123022937
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Xu C, et al.
    Control of auxin-induced callus formation by bZIP59-LBD complex in Arabidopsis regeneration.
    Nat Plants, 2018. 4(2): p. 108-115
    [PMID:29358751]