PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc00359.1.g00330.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family NAC
Protein Properties Length: 353aa    MW: 39099.8 Da    PI: 5.5874
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc00359.1.g00330.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM177.34.3e-55221481129
                             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratk 79 
                                     lppGfrFhPtdee+v++yL++k+ +++++   vi evd++k+ePwdLp+k+k +ekewyfF+++d+ky+tg+r+nrat+
  Zmw_sc00359.1.g00330.1.sm.mkhc  22 LPPGFRFHPTDEEVVTDYLTHKAVDRSFTS-IVIGEVDLNKCEPWDLPAKAKMGEKEWYFFFHKDRKYPTGTRANRATE 99 
                                     79*************************998.89***************99999************************** PP

                             NAM  80 sgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                                     +gyWkatgkd+e+++ +g lvg+kktLvfy+grap+gekt Wvmhe+rle
  Zmw_sc00359.1.g00330.1.sm.mkhc 100 TGYWKATGKDREIFR-GGILVGMKKTLVFYRGRAPRGEKTGWVMHEFRLE 148
                                     ***************.*******************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.44E-6214171IPR003441NAC domain
PROSITE profilePS5100557.9122171IPR003441NAC domain
PfamPF023653.4E-2623147IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 353 aa     Download sequence    Send to blast
MSEVSVINQA EMEDQASGQL ELPPGFRFHP TDEEVVTDYL THKAVDRSFT SIVIGEVDLN  60
KCEPWDLPAK AKMGEKEWYF FFHKDRKYPT GTRANRATET GYWKATGKDR EIFRGGILVG  120
MKKTLVFYRG RAPRGEKTGW VMHEFRLEGK LPHSLPRSAK DEWAVCKVFN KDLLAAKTGT  180
PMAAAGAELD HVESLEFLSE FLDSAQLPPL MDPTYGADVD EVIDFKGLAS TSGQHGAASS  240
GGSYPPLKME EQYLHHDQQR PQTFHSSASP YFSLPAANAG DDVPAAIRRY CKAEQKASVL  300
SPSRETGLSA DPNAAAGYAD ISSAATPSSL HQHNQFLQEL DDPLLNLADI WKY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A3e-531917714171NO APICAL MERISTEM PROTEIN
1ut4_B3e-531917714171NO APICAL MERISTEM PROTEIN
1ut7_A3e-531917714171NO APICAL MERISTEM PROTEIN
1ut7_B3e-531917714171NO APICAL MERISTEM PROTEIN
3swm_A3e-531917717174NAC domain-containing protein 19
3swm_B3e-531917717174NAC domain-containing protein 19
3swm_C3e-531917717174NAC domain-containing protein 19
3swm_D3e-531917717174NAC domain-containing protein 19
3swp_A3e-531917717174NAC domain-containing protein 19
3swp_B3e-531917717174NAC domain-containing protein 19
3swp_C3e-531917717174NAC domain-containing protein 19
3swp_D3e-531917717174NAC domain-containing protein 19
4dul_A3e-531917714171NAC domain-containing protein 19
4dul_B3e-531917714171NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtBinds to the promoter regions of genes involved in chlorophyll catabolic processes, such as NYC1, SGR1, SGR2 and PAO. {ECO:0000269|PubMed:27021284}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00518DAPTransfer from AT5G18270Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004984514.10.0NAC domain-containing protein 79
SwissprotQ9FK447e-91NAC87_ARATH; NAC domain-containing protein 87
TrEMBLA0A368SRF40.0A0A368SRF4_SETIT; Uncharacterized protein
STRINGSi035639m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP186238104
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]