PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc00359.1.g00310.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family NAC
Protein Properties Length: 369aa    MW: 39949.1 Da    PI: 8.1476
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc00359.1.g00310.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM174.23.8e-5491361128
                             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratk 79 
                                     lppGfrFhPtdeel+v+yL++++ ++++++  +i++vdiyk++PwdLp+k++ ++kewyfFs+rd+ky++g r+nra+ 
  Zmw_sc00359.1.g00310.1.sm.mkhc   9 LPPGFRFHPTDEELIVHYLRNRAGSSPIPV-AIIADVDIYKFNPWDLPSKAAYGDKEWYFFSPRDRKYPNGIRPNRAAG 86 
                                     79****************************.88***************888889************************* PP

                             NAM  80 sgyWkatgkdkevlsk.kgelvglkktLvfykgrapkgektdWvmheyrl 128
                                     sgyWkatg+dk+++s+ +ge vg+kk Lvfykgr pkg+kt+W+mheyrl
  Zmw_sc00359.1.g00310.1.sm.mkhc  87 SGYWKATGTDKPIHSTtTGESVGVKKALVFYKGRPPKGTKTNWIMHEYRL 136
                                     **************9978999***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.88E-653169IPR003441NAC domain
PROSITE profilePS5100562.6099169IPR003441NAC domain
PfamPF023651.5E-2710136IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 369 aa     Download sequence    Send to blast
MIMANTAMLP PGFRFHPTDE ELIVHYLRNR AGSSPIPVAI IADVDIYKFN PWDLPSKAAY  60
GDKEWYFFSP RDRKYPNGIR PNRAAGSGYW KATGTDKPIH STTTGESVGV KKALVFYKGR  120
PPKGTKTNWI MHEYRLAADA NAGHAYRPMK FRNASMRLDD WVLCRIYMKT SHAASPMAVP  180
PLFDHEQDEP CGFDETSYAT SSAGMILPGA AAGAFPMQQD AAAGTQTMPR ILSISELLND  240
YPLEPFFDDG GVQDTARLDQ QHHHAALLGH PVASHLLVNN GDNSMSGQLL LANATATTSA  300
AGDGVTAGIK RKRSELESGA SALASHQAAA AKKPNGSCFG ATFQTGNGLQ GSLNQLGHQM  360
LLHPNMGMH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A2e-73917320172NAC domain-containing protein 19
3swm_B2e-73917320172NAC domain-containing protein 19
3swm_C2e-73917320172NAC domain-containing protein 19
3swm_D2e-73917320172NAC domain-containing protein 19
3swp_A2e-73917320172NAC domain-containing protein 19
3swp_B2e-73917320172NAC domain-containing protein 19
3swp_C2e-73917320172NAC domain-containing protein 19
3swp_D2e-73917320172NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor of the NAC family associated with male fertility. Involved in anther development, but not in senescence. Reduced expression of NAC5 via RNAi leads to male-sterility. {ECO:0000269|PubMed:22278768}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated by drought, salt and cold treatments. {ECO:0000269|PubMed:18813954}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025798103.10.0NAC domain-containing protein 10-like
SwissprotQ8H4S41e-82NAC10_ORYSJ; NAC domain-containing protein 10
TrEMBLA0A3G2LN220.0A0A3G2LN22_9POAL; NAC transcription factor
STRINGPavir.Ia03443.1.p1e-177(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP123736123
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]