PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc00338.1.g00010.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family NAC
Protein Properties Length: 1024aa    MW: 112810 Da    PI: 9.6472
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc00338.1.g00010.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM164.92.9e-512373661129
                           NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvka.eekewyfFskrdkkyatgkrknrat 78 
                                   +ppGfrFhPtdeel+ +yLkkk+  +k++l evi+evd++k+ePw+L++  ++ +  ++ewyfFs++d+ky+tg+r+nrat
  Zmw_sc00338.1.g00010.1.am.mk 237 VPPGFRFHPTDEELLLYYLKKKIGFEKFDL-EVIREVDLNKIEPWELQErcRIGSaPQNEWYFFSHKDRKYPTGSRTNRAT 316
                                   69****************************.99**************963433332566********************** PP

                           NAM  79 ksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                                   ++g+Wkatg+dk + + + +++g++ktLvfy+grap+g+ktdW+mhe+rle
  Zmw_sc00338.1.g00010.1.am.mk 317 TAGFWKATGRDKCIRT-SYRKIGMRKTLVFYRGRAPHGQKTDWIMHEFRLE 366
                                   ***************9.8999***************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.1E-59228388IPR003441NAC domain
PROSITE profilePS5100557.334237388IPR003441NAC domain
PfamPF023655.3E-26238365IPR003441NAC domain
Gene3DG3DSA:3.20.20.702.2E-1396571018IPR013785Aldolase-type TIM barrel
SuperFamilySSF513951.34E-1216591017No hitNo description
CDDcd029336.75E-175660999No hitNo description
PfamPF007242.0E-83661995IPR001155NADH:flavin oxidoreductase/NADH oxidase, N-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0055114Biological Processoxidation-reduction process
GO:0003677Molecular FunctionDNA binding
GO:0010181Molecular FunctionFMN binding
GO:0016491Molecular Functionoxidoreductase activity
Sequence ? help Back to Top
Protein Sequence    Length: 1024 aa     Download sequence    Send to blast
MHAWVFEMQP ADGEFKNRAW SLPEAQAFMA TTFHLAREEA CYQDRAASKW HRKQAQSGRH  60
RSHSKRPRVV ALELESPAMT GRARFLARID RVLRMQPSER ARPAPARGPA VPARPHRDPR  120
LPRGRRARAR VRVTAEQWMS LKVHAPWVWT TTDPRGIWQL TELPARARMA VPCVLRDHLL  180
SPSTAAAAGV NSSRPRPPPP PRSCGPRSPA SKLLKAEGSS SRGKGVVMAV FSSSNGVPPG  240
FRFHPTDEEL LLYYLKKKIG FEKFDLEVIR EVDLNKIEPW ELQERCRIGS APQNEWYFFS  300
HKDRKYPTGS RTNRATTAGF WKATGRDKCI RTSYRKIGMR KTLVFYRGRA PHGQKTDWIM  360
HEFRLEEADD AQGGTSEDGW VVCRVFKKKC FFKIGGGGEG SASQGADAGG HLAASPPLGG  420
HQSVLASHYI HPHHQYYHAA SSYYSQMQVP AAYSHHVQVQ DLLTNHRPTA DAAGYDFSGL  480
PVEHSAAAGG LDVGSSDGVA ADGAQMEGRD QASGAAEQQW QAIDGFGNGA GNGAVQQMTG  540
AMSSGQRGGE MDLWGYGRAA SRVGSPKPAT RVRNQEATGN NPGDLWLWRC VVAERGQLGR  600
LGSWLPRPKL HGCTFLRRRE VERPCSVHAV SVVGRSPKPR SRMGDDRHAV AGGEQTKTIP  660
LLTPYKMGRF QLSHRVVLAP LTRQRSFGCV PQPHAAVYYA QRATQGGFLI AEATGVSHAA  720
QGYPDTPGLW TREQVEAWKP VVDAVHAKGG VFFCQIWHTG RASNYEFQPN GQAPVSSTDR  780
QVAHKESADG LSVTSYAVPR RLRTDEIPAI VDDFRIAARN AIEAGFDGVE VHAAHGYLID  840
QFLKDGVNDR TDEYGGSLAN RCRFALEVVA AVAAEIGADR VGVRVSPYTD YMDATDSDPD  900
ALGAHVARAL GELGVLYLHA VEPRMLRPTE RGETRHSLRP MRDAFGGTFI VAGAYAREDG  960
CRAVADGYAD LVAYGRLFLA NPDLPRRFAL DAPLNKYDRE TFYTPDPVIG YTDYPFLGDD  1020
DLSK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1vji_A0.06501017136812-oxophytodienoate reductase (OPR1)
2q3r_A0.06501017136812-oxophytodienoate reductase 1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
15867RHRSHSKRPR
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A0D9ZL910.0A0A0D9ZL91_9ORYZ; Uncharacterized protein
STRINGOGLUM04G13590.10.0(Oryza glumipatula)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP92973046