PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc00330.1.g00110.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family NAC
Protein Properties Length: 273aa    MW: 30178.3 Da    PI: 9.6042
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc00330.1.g00110.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM113.62e-35151431128
                           NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksg 81 
                                   l+pG++F+Ptd++lvv+yL+ ++ + +l+   +i++ di++++P+dL    +++ +e +fF +r  ++++++r +r++k+g
  Zmw_sc00330.1.g00110.1.sm.mk  15 LAPGYKFNPTDQDLVVRYLRCRAVNYQLSS-AIIADKDILDHHPSDLV---SETGSEKFFFYRRVLRSENDTRWKRTAKHG 91 
                                   579************************999.78**************6...44567999********************** PP

                           NAM  82 yWkatgkdkevlsk..kgel.....vglkktLvfykgrapkgektdWvmheyrl 128
                                   yW+a+gk+ +++++  +        vg+k+tLvfy+g+ p+ge+tdWvm ey l
  Zmw_sc00330.1.g00110.1.sm.mk  92 YWRASGKEVPIFCTsvS--SgvplmVGIKRTLVFYHGKPPSGERTDWVMREYCL 143
                                   *************7441..356788***************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.44E-3612153IPR003441NAC domain
PROSITE profilePS5100537.13315211IPR003441NAC domain
PfamPF023652.5E-1817143IPR003441NAC domain
SuperFamilySSF1019411.44E-36199211IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 273 aa     Download sequence    Send to blast
MAASIPLASG ATIPLAPGYK FNPTDQDLVV RYLRCRAVNY QLSSAIIADK DILDHHPSDL  60
VSETGSEKFF FYRRVLRSEN DTRWKRTAKH GYWRASGKEV PIFCTSVSSG VPLMVGIKRT  120
LVFYHGKPPS GERTDWVMRE YCLAGGGLSP YRMMRPCMKN NSGHINGTVK VTSKEHYGPS  180
VTPHITAPSI ENVNIMVNPD SSWVICRIHK KKARKPTIII RANNNAGVEK IRFYDFLGQG  240
NHDDGTASSS ATPMENSEVK GGSSENASTE DGI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A4e-221321315167NO APICAL MERISTEM PROTEIN
1ut4_B4e-221321315167NO APICAL MERISTEM PROTEIN
1ut7_A4e-221321315167NO APICAL MERISTEM PROTEIN
1ut7_B4e-221321315167NO APICAL MERISTEM PROTEIN
3swm_A4e-221321318170NAC domain-containing protein 19
3swm_B4e-221321318170NAC domain-containing protein 19
3swm_C4e-221321318170NAC domain-containing protein 19
3swm_D4e-221321318170NAC domain-containing protein 19
3swp_A4e-221321318170NAC domain-containing protein 19
3swp_B4e-221321318170NAC domain-containing protein 19
3swp_C4e-221321318170NAC domain-containing protein 19
3swp_D4e-221321318170NAC domain-containing protein 19
4dul_A4e-221321315167NAC domain-containing protein 19
4dul_B4e-221321315167NAC domain-containing protein 19
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP44822369