PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc00326.1.g00460.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family NAC
Protein Properties Length: 991aa    MW: 107641 Da    PI: 7.3318
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc00326.1.g00460.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM162.22e-504926201128
                           NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvka.eekewyfFskrdkkyatgkrknrat 78 
                                   +ppGfrFhPt+eel+++yLkkkv++++++l +vi++vd++k+ePwd+++   + +  +++wy Fs++dkky+tg+r+nrat
  Zmw_sc00326.1.g00460.1.am.mk 492 VPPGFRFHPTEEELLTYYLKKKVASERMDL-DVIRDVDLNKLEPWDIQEkcGIGSgPQNDWYLFSHKDKKYPTGTRTNRAT 571
                                   69****************************.9***************952433332556********************** PP

                           NAM  79 ksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                                   ++g+Wkatg+dk+++s  ++ +g++ktLvfykgrap+g+k+dW+mheyrl
  Zmw_sc00326.1.g00460.1.am.mk 572 AAGFWKATGRDKAIYS-CTRRIGMRKTLVFYKGRAPHGQKSDWIMHEYRL 620
                                   ****************.9999***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.31E-52490625IPR003441NAC domain
PROSITE profilePS5100550.024492660IPR003441NAC domain
PfamPF023654.0E-26493620IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 991 aa     Download sequence    Send to blast
MAVSPSSTAA AAALGVVALL LAAAAVPPAA AEIRETVIRG DPRSIIPLDE FGFTHSGVLE  60
LNTITSTSYR YLWTSVVAGE LATLAFYVFT GYRFRPKVHY PYFVINDEEE EAAAEALNLA  120
MAGLHATSFT NGVGDGSRSD SQMVLVDRHL LPQACLNGDV DETTQRSAEC WTPSLRRGGE  180
VSRGTTEFAC GAAVGKPGLT RKRHYGVLLI RNELTNQPVE REVRSSSYTS RSVIFFQCVV  240
AVVATSSSTR SPIVPWHAAV ITLQQEGELN LDGDKAHVRS PSSSLLLHAL LSESTIQHEG  300
TPIDPEEVPD LVSTCQPGAR ASWLQRATTK TCESENYRIG RDLCRQQRPR ILAYGILERA  360
RRERKNQLEK NTSISLSVAV ADAVTVVAVV AGRGGYAGHP RHHDMPPQHH STDDFSPRPG  420
VAPMRFRLAV LFPEIFKFVC HGSGCYMALF CVPRLLPLVV NLPLPPSLSS SHFFLPGLAR  480
LAGTNPRLKS VVPPGFRFHP TEEELLTYYL KKKVASERMD LDVIRDVDLN KLEPWDIQEK  540
CGIGSGPQND WYLFSHKDKK YPTGTRTNRA TAAGFWKATG RDKAIYSCTR RIGMRKTLVF  600
YKGRAPHGQK SDWIMHEYRL DDADHPTAAA AGDPHYPSPP LASSRTPPSQ QHATVHVMVD  660
DDEVEISLSW VWGLSASSIT RSADERRRGG CVGVNRATES AHPQDHQTCV PQAADEPTKH  720
RPAPAAGSHS AHRQALVVDF CERRRLHQQR DKNGTPPIRG GAAAGEQEAQ EEGWAICRMF  780
KKKNLVLHHG QSNGSGATVA ATVVSKMASV PSAMESSPTS NGSSSVTVRD HVKAAQMLHS  840
GSNVDALDHI LQYMGRSFGD DNNQDTKPPA ALQMDHHHLA AACPSSSFYG KFMKLPPLEH  900
DGSVLLPNPA ATDASGIADW DSLDRLAAYE LNGISDASKN MVSFFDEPSA AATTGAFTSA  960
YTSAGAGDGD LWSLARSSVS SLHADLTMNN V
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A4e-4349262015140Stress-induced transcription factor NAC1
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A1D6NW321e-120A0A1D6NW32_MAIZE; NAC domain-containing protein 43
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP3624234