PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc00326.1.g00040.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family GRAS
Protein Properties Length: 629aa    MW: 67633.2 Da    PI: 5.5438
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc00326.1.g00040.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS75.97.3e-242813832102
                          GRAS   2 velLlecAeavssgdlelaqalLarlselaspdg.dpmqRlaayfteALaarlarsvselykalppsetsekn.sseelaa 80 
                                   v +L++cA+ +++ d ++a+ +Larl  +asp+g +pm+R+aayf+eALa r++r++++l++  pp+e ++    ++ + a
  Zmw_sc00326.1.g00040.1.sm.mk 281 VGALTACADSLAAYDYQAANYYLARLGMIASPAGpTPMHRVAAYFAEALAIRVVRTWPHLFDVTPPRELTDGAvGDDDAVA 361
                                   678*****************************************************************998887899999* PP

                          GRAS  81 lklfsevsPilkfshltaNqaI 102
                                   l++++ ++Pi++f h+t N+ +
  Zmw_sc00326.1.g00040.1.sm.mk 362 LRVLNAITPIPRFLHFTINERL 383
                                   *******************875 PP

2GRAS163.12.3e-50380571183374
                          GRAS 183 akrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealey 263
                                    +rled++l++L+vk gE++aVn+vl++hrll ++  +  +  ++L l +s+ + ++ + e+++ +ns+++ +rf+ al+y
  Zmw_sc00326.1.g00040.1.sm.mk 380 NERLEDVRLWMLHVKGGECVAVNCVLAVHRLLCNENGT--ALADFLGLARSTGAAILLLGERDVALNSGRWEARFACALRY 458
                                   5799***************************9554444..4589************************************* PP

                          GRAS 264 ysalfdsl.eaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrk 343
                                   y+a fd++ +a+l+ +s +r+kvE++ ++rei+++va ega+r erhet++ Wr+ +ee+GFk++ l++++a+q +++ r+
  Zmw_sc00326.1.g00040.1.sm.mk 459 YAAAFDAVdAAGLAYTSLARAKVEEM-FAREIRSAVAFEGADRLERHETFAGWRRLMEECGFKNAGLGNREAMQGRMITRM 538
                                   ********9999**************.****************************************************** PP

                          GRAS 344 vksdgyrveee..sgslvlgWkdrpLvsvSaWr 374
                                   ++   y+v+ +   ++l+l W ++++++vSaW+
  Zmw_sc00326.1.g00040.1.sm.mk 539 FAPSNYSVQAQgdGEALTLQWLNQAMYTVSAWT 571
                                   **666***9654256677**************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098515.641374549IPR005202Transcription factor GRAS
PfamPF035148.0E-48380571IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 629 aa     Download sequence    Send to blast
MEVSTCRSLG LAVDAVRALR SGMVAALQQE ENEEEGTEEE ERSGSLPGTS HPAVSRISRM  60
LAGCSFTSSR HHMSTTQRFD ILQCGLSKRS NRGGDGAAAQ RVAAADASTG GATCSFRAHP  120
APPVAQAVSW GAKPEPSGNV AGGGVWERSR AVKRAHEEDV VEEYGGPIVR AKRTRMGGEG  180
DEVWFRQPIA GTVQQAAPGE GEEGDEEKVF LVPSAAAFPH GMAAAGPSLA AAKQEEFSNS  240
PSPASSVGTD GGSSAVPPPD VHARNGVPLT GEVAREAMEL VGALTACADS LAAYDYQAAN  300
YYLARLGMIA SPAGPTPMHR VAAYFAEALA IRVVRTWPHL FDVTPPRELT DGAVGDDDAV  360
ALRVLNAITP IPRFLHFTIN ERLEDVRLWM LHVKGGECVA VNCVLAVHRL LCNENGTALA  420
DFLGLARSTG AAILLLGERD VALNSGRWEA RFACALRYYA AAFDAVDAAG LAYTSLARAK  480
VEEMFAREIR SAVAFEGADR LERHETFAGW RRLMEECGFK NAGLGNREAM QGRMITRMFA  540
PSNYSVQAQG DGEALTLQWL NQAMYTVSAW TPRPTAAQQE ARLSEEERTG FFSVSGFLLL  600
PFHIKERIER DKTTMDLRSG EVILTPWWS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A3e-18393570197374GRAS family transcription factor containing p
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004964401.11e-155PREDICTED: scarecrow-like protein 28
TrEMBLK3Y2011e-155K3Y201_SETIT; Uncharacterized protein
STRINGSi008220m1e-154(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP64043455