PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc00322.1.g00280.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family ZF-HD
Protein Properties Length: 292aa    MW: 30702.3 Da    PI: 7.9371
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc00322.1.g00280.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer101.46e-3268121357
                   ZF-HD_dimer   3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrev 57 
                                   ++rY+eClkNhA+ +GghavDGCgEfm++ geeg+++al+CaACgCHRnFHR+e+
  Zmw_sc00322.1.g00280.1.am.mk  68 TTRYRECLKNHAVGIGGHAVDGCGEFMAA-GEEGSINALRCAACGCHRNFHRKES 121
                                   579*************************9.999********************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF047705.0E-2969121IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015661.7E-2970120IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
ProDomPD1257743.0E-2470123IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152327.73571120IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
SuperFamilySSF466895.31E-21217288IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.608.8E-33218288IPR009057Homeodomain-like
TIGRFAMsTIGR015654.4E-27227283IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 292 aa     Download sequence    Send to blast
MDFDEHDDGD EEMPPMPVSS SYDAPMQPGI VQGGSGSTPK PADSGGGGSF STPGGGSGGV  60
GGRAGGGTTR YRECLKNHAV GIGGHAVDGC GEFMAAGEEG SINALRCAAC GCHRNFHRKE  120
SGSPTGAEPV ALSPAAITPY GVAAPHQFSP YYRTPAGYLY HQQQHQQHLA AAAAAGHMHR  180
PLALPSTSHS GGRDEGDDIS RMIGPMVVAP MVGMSLSSGG GASGSGKKRF RTKFTQEQKD  240
RMLAFAERLG WRIQKHDEAA VQQFCEEVGV KRQVLKVWMH NNKHTLGRKP LP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A5e-302282851875ZF-HD homeobox family protein
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
16066GGRAGGG
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001149424.21e-142uncharacterized protein LOC100283050
SwissprotA2YWA61e-122ZHD2_ORYSI; Zinc-finger homeodomain protein 2
SwissprotQ6ZB901e-122ZHD2_ORYSJ; Zinc-finger homeodomain protein 2
TrEMBLA0A096TBY01e-142A0A096TBY0_MAIZE; Uncharacterized protein
STRINGGRMZM2G346920_P011e-141(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP39503269