PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc00322.1.g00180.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family bHLH
Protein Properties Length: 279aa    MW: 29905.5 Da    PI: 10.0365
Description bHLH family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc00322.1.g00180.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HLH41.52.5e-132172354
                                  HHHHHHHHHHHHHHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHH CS
                           HLH  3 rahnerErrRRdriNsafeeLrellPkaskapskKlsKaeiLekAveYIksL 54
                                  r+h+e+Er+RR+riN  +++Lr+l+P+as+     ++Ka+ L ++v+++++L
  Zmw_sc00322.1.g00180.1.am.mk 21 RSHSEAERKRRQRINAHLATLRTLVPSASRLVVAQMDKAALLGEVVRHVREL 72
                                  58*************************999*******************998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF474593.66E-121577IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PROSITE profilePS5088815.0271872IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene3DG3DSA:4.10.280.101.3E-132175IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
CDDcd000831.24E-112175No hitNo description
PfamPF000105.6E-112172IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
SMARTSM003535.1E-112478IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene3DG3DSA:3.30.70.2608.4E-5142190No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 279 aa     Download sequence    Send to blast
MATEGECSAP AAEERKVPPV RSHSEAERKR RQRINAHLAT LRTLVPSASR LVVAQMDKAA  60
LLGEVVRHVR ELRAKASDAT EGVLGGIPGK SDEVGVVEEH DHHHHWRPDH DHHHCYGPGS  120
GHGADEDGGV DRRRPRRVRA WVCCADRPGL MSDIGRAVRS ASARPVRAEI ATVGGRTRSV  180
LELDVCDADD DDGRAVVLST LRASLRNVLL DREVHLAAAG AAEGYKRPRF SAQIGKSGGG  240
RSIGTSSCGE AQRRRRGPSC GGARAAQRGK ARAAAVQSE
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
12631ERKRRQ
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025822447.15e-83transcription factor AIG1-like
TrEMBLA0A2T8IHC41e-81A0A2T8IHC4_9POAL; Uncharacterized protein
STRINGOMERI09G10040.12e-77(Oryza meridionalis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP41143569