PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc00320.1.g00380.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family bZIP
Protein Properties Length: 304aa    MW: 33942.3 Da    PI: 7.9031
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc00320.1.g00380.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_147.92.9e-15234283555
                                     CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                          bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkke 55 
                                     +r++r++kNRe+A rsR+RK+a++ eLe+kv  L++eN++Lk + +el+k+
  Zmw_sc00320.1.g00380.1.sm.mkhc 234 RRQKRMIKNRESAARSRARKQAYTNELENKVSRLQEENERLK-RQKELEKM 283
                                     79***************************************9.88888887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1709.3E-15229282No hitNo description
SMARTSM003388.4E-11230298IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.611232277IPR004827Basic-leucine zipper domain
SuperFamilySSF579594.25E-11234279No hitNo description
CDDcd147077.95E-25234288No hitNo description
PfamPF001702.0E-12234282IPR004827Basic-leucine zipper domain
PROSITE patternPS000360237252IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009737Biological Processresponse to abscisic acid
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 304 aa     Download sequence    Send to blast
MQRLARQGSL YNLTLDEVQS HLGEPLHSMN LDELLKSVFP DGLDPDGATT SEHEQASGLL  60
RQASISMPPE LSKKTVDEVW KGIQDGPKRN AEEGSLRRRE RQPTLGEMTL EDFLVKAGVV  120
TEGYLKDLND VGNVDQVGMA GAAGLTRGAQ WLDQYQQQFT AIDAHQHGQH SIPGAYMLSR  180
LALQPLNVVP SAIVESAYSD GNITSPMMGT LSDSPTPVRK RGATGDVADK LMERRQKRMI  240
KNRESAARSR ARKQAYTNEL ENKVSRLQEE NERLKRQKEL EKMLFSTPLQ EPKYQLRRTG  300
SATF
Functional Description ? help Back to Top
Source Description
UniProtBinds to the embryo specification element and the ABA-responsive element (ABRE) of the Dc3 gene promoter. Could participate in abscisic acid-regulated gene expression during seed development.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00409DAPTransfer from AT3G56850Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025818578.10.0ABSCISIC ACID-INSENSITIVE 5-like protein 2 isoform X1
SwissprotQ9LES39e-78AI5L2_ARATH; ABSCISIC ACID-INSENSITIVE 5-like protein 2
TrEMBLA0A3L6SJ470.0A0A3L6SJ47_PANMI; ABSCISIC ACID-INSENSITIVE 5-like protein 2
STRINGPavir.Eb03523.1.p0.0(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP27073883
Publications ? help Back to Top
  1. Kim H, et al.
    ABA-HYPERSENSITIVE BTB/POZ PROTEIN 1 functions as a negative regulator in ABA-mediated inhibition of germination in Arabidopsis.
    Plant Mol. Biol., 2016. 90(3): p. 303-15
    [PMID:26667153]
  2. Song C,Kim T,Chung WS,Lim CO
    The Arabidopsis Phytocystatin AtCYS5 Enhances Seed Germination and Seedling Growth under Heat Stress Conditions.
    Mol. Cells, 2017. 40(8): p. 577-586
    [PMID:28756655]