PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc00320.1.g00190.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family NAC
Protein Properties Length: 312aa    MW: 35324.9 Da    PI: 7.2145
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc00320.1.g00190.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM170.17.2e-53201471128
                             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratk 79 
                                     lppGfrFhPtdeelvv+yL++kv++++l++  +i+evd+yk++PwdLp+k+  ++kewyfF++rd+ky++g+r+nra+ 
  Zmw_sc00320.1.g00190.1.am.mkhc  20 LPPGFRFHPTDEELVVHYLCRKVARQQLPV-PIIAEVDLYKFDPWDLPEKALFGRKEWYFFTPRDRKYPNGSRPNRAAG 97 
                                     79****************************.88***************8877899************************ PP

                             NAM  80 sgyWkatgkdkevlsk.kgelvglkktLvfykgrapkgektdWvmheyrl 128
                                     +gyWkatg dk++  k + ++ g+kk Lvfy+g+ap+g+ktdW+mheyrl
  Zmw_sc00320.1.g00190.1.am.mkhc  98 RGYWKATGADKPIAPKgSPKAAGIKKALVFYSGKAPRGVKTDWIMHEYRL 147
                                     **************98556779**************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.48E-6316173IPR003441NAC domain
PROSITE profilePS5100560.97120173IPR003441NAC domain
PfamPF023652.8E-2721147IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 312 aa     Download sequence    Send to blast
MGMVAAEGSG RRDAEAELNL PPGFRFHPTD EELVVHYLCR KVARQQLPVP IIAEVDLYKF  60
DPWDLPEKAL FGRKEWYFFT PRDRKYPNGS RPNRAAGRGY WKATGADKPI APKGSPKAAG  120
IKKALVFYSG KAPRGVKTDW IMHEYRLADA DRGPGKKGSQ KLDEWVLCRL YNKKNNWEKV  180
KVEELQEQET APHHRQRKEE IMDTLADTMS DSIQTHGSEI DNAPGMQNSF GDMAQGQATV  240
PNSMVTVKED NDWFTDMNFD ELQASYMNMG QMVNPSLGQT VNPAAGQDYH AGYLQSISAP  300
QMRMWQTILP PF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A3e-95121797174Stress-induced transcription factor NAC1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in stress response. {ECO:0000250|UniProtKB:Q7F2L3}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by salt stress (PubMed:18813954, PubMed:20632034). Induced by dehydration, cold stress and methyl jasmonate (PubMed:20632034). {ECO:0000269|PubMed:18813954, ECO:0000269|PubMed:20632034}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025816775.10.0NAC domain-containing protein 68-like
SwissprotQ52QH41e-163NAC68_ORYSJ; NAC domain-containing protein 68
TrEMBLA0A220T1T20.0A0A220T1T2_9POAL; Stress responsive NAC transcription factor
STRINGSi002386m1e-178(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP53893761
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Taga Y, et al.
    Role of OsHSP90 and IREN, Ca2+ dependent nuclease, in plant hypersensitive cell death induced by transcription factor OsNAC4.
    Plant Signal Behav, 2009. 4(8): p. 740-2
    [PMID:19820348]
  3. Xia N, et al.
    Characterization of a novel wheat NAC transcription factor gene involved in defense response against stripe rust pathogen infection and abiotic stresses.
    Mol. Biol. Rep., 2010. 37(8): p. 3703-12
    [PMID:20213512]
  4. Takasaki H, et al.
    The abiotic stress-responsive NAC-type transcription factor OsNAC5 regulates stress-inducible genes and stress tolerance in rice.
    Mol. Genet. Genomics, 2010. 284(3): p. 173-83
    [PMID:20632034]
  5. Nakayama A, et al.
    Genome-wide identification of WRKY45-regulated genes that mediate benzothiadiazole-induced defense responses in rice.
    BMC Plant Biol., 2013. 13: p. 150
    [PMID:24093634]
  6. Ootsubo Y,Hibino T,Wakazono T,Mukai Y,Che FS
    IREN, a novel EF-hand motif-containing nuclease, functions in the degradation of nuclear DNA during the hypersensitive response cell death in rice.
    Biosci. Biotechnol. Biochem., 2016. 80(4): p. 748-60
    [PMID:26766411]