PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc00310.1.g00050.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family NAC
Protein Properties Length: 147aa    MW: 17349.9 Da    PI: 9.7194
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc00310.1.g00050.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM146.11.9e-45161321117
                           NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksg 81 
                                   + pGfrFhPtdeel+ +yLk+k+++k+l++ e i+++diyk++PwdLpk ++++ekewyf+++rd+ky++++r+nr+t +g
  Zmw_sc00310.1.g00050.1.sm.mk  16 MLPGFRFHPTDEELIGFYLKRKIQHKSLPI-ELIRQLDIYKYDPWDLPKLASTGEKEWYFYCPRDRKYRNSTRPNRVTGAG 95 
                                   579***************************.89***************9888999************************** PP

                           NAM  82 yWkatgkdkevlsk.kgelvglkktLvfykgrapkge 117
                                   +Wkatg+d++++s+ +++ +glkk+Lvfykgra kg 
  Zmw_sc00310.1.g00050.1.sm.mk  96 FWKATGTDRPIYSSdGSKCIGLKKSLVFYKGRAAKGY 132
                                   *************966677**************9985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019419.02E-4812132IPR003441NAC domain
PROSITE profilePS5100545.54116147IPR003441NAC domain
PfamPF023658.7E-2118129IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 147 aa     Download sequence    Send to blast
MDEIRSDDME KQEEVMLPGF RFHPTDEELI GFYLKRKIQH KSLPIELIRQ LDIYKYDPWD  60
LPKLASTGEK EWYFYCPRDR KYRNSTRPNR VTGAGFWKAT GTDRPIYSSD GSKCIGLKKS  120
LVFYKGRAAK GYTKKSALLR EHIVYND
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A4e-4441313128Stress-induced transcription factor NAC1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtPromotes periclinal root capforming cell divisions. Activates expression of its negative regulator SMB in a feedback loop for controlled switches in cell division plane. {ECO:0000269|PubMed:19081078}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Repressed by SMB in oriented-divised root cap stem cells. {ECO:0000269|PubMed:19081078}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_022679437.11e-90putative NAC domain-containing protein 94
SwissprotQ9ZVH02e-78FEZ_ARATH; Protein FEZ
TrEMBLK3YYF72e-89K3YYF7_SETIT; Uncharacterized protein
STRINGPavir.Ab02998.1.p4e-90(Panicum virgatum)
STRINGSi019308m4e-90(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP33663882
Publications ? help Back to Top
  1. Bennett T,van den Toorn A,Willemsen V,Scheres B
    Precise control of plant stem cell activity through parallel regulatory inputs.
    Development, 2014. 141(21): p. 4055-64
    [PMID:25256342]