PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc00296.1.g00490.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family HD-ZIP
Protein Properties Length: 280aa    MW: 30805.9 Da    PI: 4.5059
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc00296.1.g00490.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox59.36.3e-193183456
                                    -SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
                        Homeobox  4 RttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                                    ++++  eq+++Le+ Fe +++++  +++++A++lgL+ rqV vWFqNrRa++k
  Zmw_sc00296.1.g00490.1.sm.mkhc 31 KRRLALEQVRALERSFETDNKLDPGRKARIARELGLQPRQVAVWFQNRRARWK 83
                                    4467789*********************************************9 PP

2HD-ZIP_I/II129.41.5e-4129121193
                     HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeener 79 
                                     ekkrrl+ eqv++LE+sFe+++kL+p rK+++areLglqprqvavWFqnrRAR+ktkqlE+d++aL++++d+l+++ ++
  Zmw_sc00296.1.g00490.1.sm.mkhc  29 EKKRRLALEQVRALERSFETDNKLDPGRKARIARELGLQPRQVAVWFQNRRARWKTKQLERDFAALRARHDSLRADCDA 107
                                     69***************************************************************************** PP

                     HD-ZIP_I/II  80 LekeveeLreelke 93 
                                     L++++++L++e++e
  Zmw_sc00296.1.g00490.1.sm.mkhc 108 LHRDKDALAAEIRE 121
                                     *********99986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.06E-182787IPR009057Homeodomain-like
SMARTSM003895.6E-192889IPR001356Homeobox domain
PROSITE profilePS5007116.522985IPR001356Homeobox domain
CDDcd000867.49E-183086No hitNo description
PfamPF000463.7E-163183IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.5E-193784IPR009057Homeodomain-like
PRINTSPR000311.3E-55665IPR000047Helix-turn-helix motif
PROSITE patternPS0002706083IPR017970Homeobox, conserved site
PRINTSPR000311.3E-56581IPR000047Helix-turn-helix motif
PfamPF021832.5E-1585126IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 280 aa     Download sequence    Send to blast
MEQEETEMDD DEDELADGRA ARSACGLGEK KRRLALEQVR ALERSFETDN KLDPGRKARI  60
ARELGLQPRQ VAVWFQNRRA RWKTKQLERD FAALRARHDS LRADCDALHR DKDALAAEIR  120
ELRQKLSKPE AAVKVEATCN DAVEDRQAAF GTSATIAVYK DGSSDSDSSV VFNDVEASPY  180
SGAVLEQPPQ QAGFVGFGES FMDSSAAATM GCPSFGTKWQ HGSMTYPCDD PYKAGSYGIM  240
EEWLAGSDVI SNDGAAGFFS DEHAPSLNFS WCASVAEGWD
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
17785RRARWKTKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002465732.11e-118homeobox-leucine zipper protein HOX13 isoform X2
SwissprotQ10QP32e-97HOX13_ORYSJ; Homeobox-leucine zipper protein HOX13
TrEMBLA0A0A9PIJ11e-129A0A0A9PIJ1_ARUDO; Uncharacterized protein
STRINGPavir.Ia04906.1.p1e-118(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP42833170
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]