PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc00276.1.g00230.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family NAC
Protein Properties Length: 657aa    MW: 73119.7 Da    PI: 9.7796
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc00276.1.g00230.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM136.51.7e-42201371116
                           NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksg 81 
                                   lppGfrFhP+dee++++yL +kv ++++++  +i+e+di+++ePw+Lp+k+k +ekewyf++ +d+ky++g+r nrat++g
  Zmw_sc00276.1.g00230.1.am.mk  20 LPPGFRFHPSDEEIITFYLMPKVLNSNFTA-VAIAEADINNSEPWELPRKAKMGEKEWYFYCLKDHKYQKGERINRATNAG 99 
                                   79*************************999.67***************99999**************************** PP

                           NAM  82 yWkatgkdkevlskkgel...vglkktLvfykgrapkg 116
                                   +Wkatgkdke++++++     vg+kktLvfy+grap+g
  Zmw_sc00276.1.g00230.1.am.mk 100 FWKATGKDKEIYQASSMMpaiVGMKKTLVFYTGRAPRG 137
                                   *************84443566***************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.18E-4417138IPR003441NAC domain
PROSITE profilePS5100540.51820166IPR003441NAC domain
PfamPF023658.1E-1921132IPR003441NAC domain
Gene3DG3DSA:1.10.630.104.2E-98188654IPR001128Cytochrome P450
SuperFamilySSF482641.7E-101200654IPR001128Cytochrome P450
PfamPF000672.1E-64203634IPR001128Cytochrome P450
PRINTSPR004636.6E-14235254IPR002401Cytochrome P450, E-class, group I
PRINTSPR004636.6E-14444461IPR002401Cytochrome P450, E-class, group I
PRINTSPR003852.4E-7455472IPR001128Cytochrome P450
PRINTSPR004636.6E-14464490IPR002401Cytochrome P450, E-class, group I
PRINTSPR003852.4E-7511522IPR001128Cytochrome P450
PRINTSPR004636.6E-14550574IPR002401Cytochrome P450, E-class, group I
PRINTSPR004636.6E-14593603IPR002401Cytochrome P450, E-class, group I
PRINTSPR003852.4E-7594603IPR001128Cytochrome P450
PROSITE patternPS000860596605IPR017972Cytochrome P450, conserved site
PRINTSPR004636.6E-14603626IPR002401Cytochrome P450, E-class, group I
PRINTSPR003852.4E-7603614IPR001128Cytochrome P450
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0055114Biological Processoxidation-reduction process
GO:0003677Molecular FunctionDNA binding
GO:0005506Molecular Functioniron ion binding
GO:0016705Molecular Functionoxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen
GO:0020037Molecular Functionheme binding
Sequence ? help Back to Top
Protein Sequence    Length: 657 aa     Download sequence    Send to blast
MGDHKYEGIR GTVDDAGLNL PPGFRFHPSD EEIITFYLMP KVLNSNFTAV AIAEADINNS  60
EPWELPRKAK MGEKEWYFYC LKDHKYQKGE RINRATNAGF WKATGKDKEI YQASSMMPAI  120
VGMKKTLVFY TGRAPRGISE VPRPRDILSF TTSKSSEGVW SKALARSPPM DFSLLLALVA  180
IALPVILHLV TRAKNPRPAA RLPPGSLGVP VIGQSLGLLR AMRNNTAERW IKDQVDGYGP  240
VSKLSLFGTP TVLVTGPAAN KFVFFSDALA MRQPRSVQRI LGERSILDLC GADHKRIRGA  300
LVEFLKPDML RMYVGKIDGE VRRHVDECWS GRATVTVMPL MKRLTFDIIS PLLFGLERGA  360
LRDALANDFA GIMEGMWSVP VNLPFTAFSR SLKASARARR LLTRITRETE AKLERGEATR  420
SSDLIACLLS MTDDSGARLL SEEEIVDTSM VALVAGHDTS SILITFMVRH LANDPDTLAA  480
MVQEHDEIAK SKNKGEALTW DDLAKMKFTW RVALETLRLV PPIFGNFRTA VKDIEFGGYT  540
IPAGWQVFWT APVTHTDAAI FPDPAKFDPS RFESHQPSAA ATTAKAKAPP FSFVAFGGGP  600
RICVGMEFAR IETLVTMHHL VRRFQWRLCC KKDTFARDPM PSPLHGLPVE IEQRTCR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6a17_A1e-671906361435Cytochrome P450 90B1
6a18_A1e-671906361435Cytochrome P450 90B1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1396403RARRLLTR
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001148166.20.0taxane 13-alpha-hydroxylase precursor
TrEMBLA0A2T7EWQ30.0A0A2T7EWQ3_9POAL; Uncharacterized protein
STRINGGRMZM2G180082_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP54123