PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc00245.1.g00340.1
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family NAC
Protein Properties Length: 450aa    MW: 50357.9 Da    PI: 4.3147
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
                             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknra 77 
                                     lppGfrFhPtd el ++yLk+k+ gkkl + ++i+e+++yk+ PwdLp k ++++++ ew+fF++rdkky++g+r+nra   6 LPPGFRFHPTDVELCSYYLKRKIMGKKLLV-DAIAEIELYKFAPWDLPdKsCLRSRDLEWFFFCPRDKKYSNGSRTNRA 83 
                                     79*************************999.89**************96347777888********************* PP

                             NAM  78 tksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                                     t +gyWk++gkd++++  +++ vg kktL+f++g+apkg +tdWvm ey++  84 TPNGYWKTSGKDRTIML-NSRIVGSKKTLIFHEGKAPKGDRTDWVMYEYKM 133
                                     *****************.999****************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.66E-593156IPR003441NAC domain
PROSITE profilePS5100555.576156IPR003441NAC domain
PfamPF023651.3E-247132IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 450 aa     Download sequence    Send to blast
3D Structure ? help Back to Top
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A7e-50215711169Stress-induced transcription factor NAC1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014660428.10.0NAC domain-containing protein 82
TrEMBLA0A368QI290.0A0A368QI29_SETIT; Uncharacterized protein
STRINGPavir.J07259.1.p0.0(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number