PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc00233.1.g00090.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family NAC
Protein Properties Length: 427aa    MW: 47277 Da    PI: 9.0608
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc00233.1.g00090.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM160.65.9e-50101351128
                           NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksg 81 
                                   lppGfrF P+deelv++yL++kv++       v+ evd++++ePw+Lp  +k +++ewyfFs rd+kyatg r+nratksg
  Zmw_sc00233.1.g00090.1.am.mk  10 LPPGFRFYPSDEELVCHYLHNKVANAG----GVMVEVDLHTHEPWELPDVAKLSTNEWYFFSFRDRKYATGLRTNRATKSG 86 
                                   79**********************998....5789*************87788999************************* PP

                           NAM  82 yWkatgkdkevlsk..kgelvglkktLvfykgrapkgektdWvmheyrl 128
                                   yWkatgkd+ + +k  ++++vg++ktLvfy+grap+g kt+Wvmhe+r+
  Zmw_sc00233.1.g00090.1.am.mk  87 YWKATGKDRVIRNKaaGRAVVGMRKTLVFYRGRAPNGIKTSWVMHEFRM 135
                                   ************99888889***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019417.32E-597154IPR003441NAC domain
PROSITE profilePS5100557.58610154IPR003441NAC domain
PfamPF023656.6E-2811135IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 427 aa     Download sequence    Send to blast
MGLRDIELTL PPGFRFYPSD EELVCHYLHN KVANAGGVMV EVDLHTHEPW ELPDVAKLST  60
NEWYFFSFRD RKYATGLRTN RATKSGYWKA TGKDRVIRNK AAGRAVVGMR KTLVFYRGRA  120
PNGIKTSWVM HEFRMENLHT PPQEDWVLCR VFYKKKADAL DYAMDNEQEL AMARSAIASR  180
KYSSSSGPGY SPPFPALGGT HYHQLPPSSD HHGAAGAGSI NDFAMALLQH NNGIFDFHPQ  240
PLDSGSSVLA AAAGASRDGE QCAGGALIDL GLEEHYSYNS LMQIRQGVSL SMAMDGCVHA  300
CMHAAVGREL PGRCSIACRL RIKGDAFLAG LLRLLLHCVH VGGPVQNDVG HSSSSRPCFK  360
FKARTPWSCH FLAQIRNDND DTGLTYLHRV APTPPTRLRA RIVLPLHLRL WRAGSLFDVQ  420
GRVGMPL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A3e-4611594169NO APICAL MERISTEM PROTEIN
1ut4_B3e-4611594169NO APICAL MERISTEM PROTEIN
1ut7_A3e-4611594169NO APICAL MERISTEM PROTEIN
1ut7_B3e-4611594169NO APICAL MERISTEM PROTEIN
3swm_A4e-4611597172NAC domain-containing protein 19
3swm_B4e-4611597172NAC domain-containing protein 19
3swm_C4e-4611597172NAC domain-containing protein 19
3swm_D4e-4611597172NAC domain-containing protein 19
3swp_A4e-4611597172NAC domain-containing protein 19
3swp_B4e-4611597172NAC domain-containing protein 19
3swp_C4e-4611597172NAC domain-containing protein 19
3swp_D4e-4611597172NAC domain-containing protein 19
4dul_A3e-4611594169NAC domain-containing protein 19
4dul_B3e-4611594169NAC domain-containing protein 19
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025824302.11e-154protein CUP-SHAPED COTYLEDON 3-like
TrEMBLA0A2S3GUT51e-153A0A2S3GUT5_9POAL; Uncharacterized protein
STRINGSi017967m1e-153(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP69738166