PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc00232.1.g00320.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family NAC
Protein Properties Length: 404aa    MW: 43011.3 Da    PI: 9.1611
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc00232.1.g00320.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM170.65e-53241521128
                           NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksg 81 
                                   lppGfrFhPtdeelvv+yLkkk+ + +l++ ++i+evd+yk++Pw+Lp+k++ +e+ew+fFs+rd+ky++g r+nra++sg
  Zmw_sc00232.1.g00320.1.am.mk  24 LPPGFRFHPTDEELVVHYLKKKAVSMPLPV-TIIAEVDLYKFDPWELPAKASFGEHEWFFFSPRDRKYPNGARPNRAATSG 103
                                   79****************************.89***************9989999************************** PP

                           NAM  82 yWkatgkdkevlsk..kgelvglkktLvfykgrapkgektdWvmheyrl 128
                                   yWkatg+dk+++++  ++e+vg+kk Lvfy+g+ pkg kt+W+mheyrl
  Zmw_sc00232.1.g00320.1.am.mk 104 YWKATGTDKPIFASggSREKVGVKKALVFYRGKPPKGIKTNWIMHEYRL 152
                                   *************9777788***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019419.94E-6320191IPR003441NAC domain
PROSITE profilePS5100561.22324191IPR003441NAC domain
PfamPF023653.0E-2725152IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 404 aa     Download sequence    Send to blast
MESTDSSSGS APPQRKQPGP APHLPPGFRF HPTDEELVVH YLKKKAVSMP LPVTIIAEVD  60
LYKFDPWELP AKASFGEHEW FFFSPRDRKY PNGARPNRAA TSGYWKATGT DKPIFASGGS  120
REKVGVKKAL VFYRGKPPKG IKTNWIMHEY RLADAASSVN TSRPPPGSGG GGKAAASLRL  180
DDWVLCRIYK KVNKYGVGEH LQRSMDGGED CVEDAVGAYR LSHAATGDMT IPSGGENYTK  240
LLHHNGNNFL DGLLTVDDGS LTAGASSLNH LAAVATESPA VTKQLLAPPG STPFKWLDTS  300
AKAILPPAKT CHGFSRDTTD GGTSSLSSPA ERNHLAVPGS SAGDIGASSG GAVAVPTLLN  360
PFGMQQGAAY LHHHASFLGT SMPPETTSRA FQNPYQPAGV NWNP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A2e-702319514172Stress-induced transcription factor NAC1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor of the NAC family associated with the grain protein content (GPC). Accelerates senescence and increases nutrient remobilization from leaves to developing grains. Sequences of 11 European varieties of H.vulgare tested belongs to the same haplotype while the sequence found in H.spontaneum, an ancestor of the cultivated H.vulgare which has a higher GPC, belongs to an other haplotype. {ECO:0000269|PubMed:17124321}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00058PBMTransfer from AT1G61110Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025802635.11e-176NAC transcription factor NAM-B2-like
SwissprotA0SPJ91e-158NAM2_HORVV; NAC transcription factor NAM-2
TrEMBLA0A3L6QQR51e-178A0A3L6QQR5_PANMI; NAC transcription factor NAM-B2
STRINGPavir.J08552.1.p1e-174(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP75723649
Publications ? help Back to Top
  1. Uauy C,Distelfeld A,Fahima T,Blechl A,Dubcovsky J
    A NAC Gene regulating senescence improves grain protein, zinc, and iron content in wheat.
    Science, 2006. 314(5803): p. 1298-301
    [PMID:17124321]