PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc00231.1.g00120.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family M-type_MADS
Protein Properties Length: 568aa    MW: 60441.3 Da    PI: 8.3697
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc00231.1.g00120.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF663.9e-21277320245
                                   ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS
                        SRF-TF   2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45 
                                   + en+s rq+t+skRr gilKKA+ELS+LCd++  +++fs+tgk
  Zmw_sc00231.1.g00120.1.am.mk 277 KLENSSGRQITYSKRRSGILKKAKELSILCDIDLILLMFSPTGK 320
                                   679***************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004323.8E-29268327IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.31E-21268328IPR002100Transcription factor, MADS-box
PROSITE profilePS5006624.474268320IPR002100Transcription factor, MADS-box
PRINTSPR004046.9E-17270290IPR002100Transcription factor, MADS-box
PfamPF003191.3E-18278321IPR002100Transcription factor, MADS-box
PRINTSPR004046.9E-17290305IPR002100Transcription factor, MADS-box
PRINTSPR004046.9E-17305326IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 568 aa     Download sequence    Send to blast
LASVSSCPGR WTVAGSAPLT GQTRKRSGLD EQRRAFGGGG GARAGLPDVS RVPGTTQQGH  60
TDYQQAPSAT QVAFESAGAA CRERSFLVTL ILMHNSGSRS IWLPALCAAV LYAGTETSGI  120
DTSPKDAMGA SSVTGQLGFW GTTCRLNPSP SLPRDSLSTS SPRASFSLLA PVSPDPRTLP  180
VSPVLGPISL TLPPSLPLAL SPLLPSGSRS APLNRSTDGK LVGAFGLSVV ARSPALAPRR  240
VCVSSPPETG SSVGRGNRTP LVWLFSAMGR VKLKIKKLEN SSGRQITYSK RRSGILKKAK  300
ELSILCDIDL ILLMFSPTGK PTICIGDKRK LESLEENVAK QHMIGLQCAA AQFQNDMQLP  360
LGLTGEPNVS QWFHSGSIDM QQPVMLPDDP SLLHQRDIGC STGTSLQSYP GYFSMSKHST  420
DTGGGSEHGQ PSLQQTPPPD FSHADCLTSL HLGAQFPYTP FDHTSLLNER MFRPDVVELH  480
DGGASMEFGG GHFDLPRPGD EASFQNWASA TCGTAIFDHH QHQQQQQPHH QQQQPSSAQL  540
PAATVLAAAP FDRAVVYPGP SQHQQVMI
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
STRINGPavir.Hb00170.1.p1e-108(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP46263659