PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc00230.1.g00260.1
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family NAC
Protein Properties Length: 429aa    MW: 47360.6 Da    PI: 8.8883
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
                           NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksg 81 
                                   lppGfrFhPtdeelv++yL++kv++  +++ ++i++vd++k+ePwdLp+k++ +ekewyfFs rd+ky+tg r+nrat+sg 111 LPPGFRFHPTDEELVTYYLTRKVSDFAFTT-RAIADVDLNKCEPWDLPSKASMGEKEWYFFSMRDRKYPTGIRTNRATDSG 190
                                   79*************************999.89***************999999*************************** PP

                           NAM  82 yWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                                   yWk+tgkdke+++  g lvg+kktLvfy+grapkgekt+Wvmheyrl 191 YWKTTGKDKEIFH-CGMLVGMKKTLVFYRGRAPKGEKTSWVMHEYRL 236
                                   *************.99*****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.7E-64108257IPR003441NAC domain
PROSITE profilePS5100560.287111257IPR003441NAC domain
PfamPF023655.1E-29112236IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 429 aa     Download sequence    Send to blast
3D Structure ? help Back to Top
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A5e-5511125717165NO APICAL MERISTEM PROTEIN
1ut4_B5e-5511125717165NO APICAL MERISTEM PROTEIN
1ut7_A5e-5511125717165NO APICAL MERISTEM PROTEIN
1ut7_B5e-5511125717165NO APICAL MERISTEM PROTEIN
3swm_A5e-5511125720168NAC domain-containing protein 19
3swm_B5e-5511125720168NAC domain-containing protein 19
3swm_C5e-5511125720168NAC domain-containing protein 19
3swm_D5e-5511125720168NAC domain-containing protein 19
3swp_A5e-5511125720168NAC domain-containing protein 19
3swp_B5e-5511125720168NAC domain-containing protein 19
3swp_C5e-5511125720168NAC domain-containing protein 19
3swp_D5e-5511125720168NAC domain-containing protein 19
4dul_A5e-5511125717165NAC domain-containing protein 19
4dul_B5e-5511125717165NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00364DAPTransfer from AT3G18400Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025795943.11e-179protein CUP-SHAPED COTYLEDON 1-like
STRINGPavir.Ib03976.1.p1e-180(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number