PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc00223.1.g00240.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family NAC
Protein Properties Length: 397aa    MW: 44040.8 Da    PI: 7.8279
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc00223.1.g00240.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM168.52.2e-5231301128
                           NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratk 79 
                                   lppGfrFhPtd+elv +yLk+kv++ k+el evi+ +d+yk+ePw+Lp k  + +++ ew+fF++rd+ky++g+r+nrat+
  Zmw_sc00223.1.g00240.1.am.mk   3 LPPGFRFHPTDDELVGYYLKRKVDNLKIEL-EVIPVIDLYKSEPWELPeKsFLPKRDLEWFFFCPRDRKYPNGSRTNRATT 82 
                                   79****************************.99**************95334445667*********************** PP

                           NAM  80 sgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                                   +gyWkatgkd+++ + +g + g++ktLvfy+grap ge+tdWvmheyrl
  Zmw_sc00223.1.g00240.1.am.mk  83 TGYWKATGKDRRIAC-DGGVYGVRKTLVFYRGRAPGGERTDWVMHEYRL 130
                                   ***************.9999***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.88E-602152IPR003441NAC domain
PROSITE profilePS5100557.2263153IPR003441NAC domain
PfamPF023655.9E-294130IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 397 aa     Download sequence    Send to blast
MTLPPGFRFH PTDDELVGYY LKRKVDNLKI ELEVIPVIDL YKSEPWELPE KSFLPKRDLE  60
WFFFCPRDRK YPNGSRTNRA TTTGYWKATG KDRRIACDGG VYGVRKTLVF YRGRAPGGER  120
TDWVMHEYRL CQDLAHGASN FIGGYALCRV IKRHEAGLLQ GEPPARAKGA STAGGARGQM  180
SKVPSNSSLG SSEQLSTFTS VNSSSPPPPV DMSRGMCAVA ESCNNFQAGT ESCHWFTCHS  240
SVMLIALERS NSFSYGGDVC DMTVTDTTNE LPPPPQFAPI NWPQMPDMFF VVDDFPDAES  300
RRPAPFFGAD MGSVSEHELK WDTLSCAPMN TFPPAAAKTD MLCRQASDGV DDLAAFFFSD  360
ENRIRAGNRT GIPGIRRPKE RRGSQPCRAA RSSPAVF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-51115715169NO APICAL MERISTEM PROTEIN
1ut4_B2e-51115715169NO APICAL MERISTEM PROTEIN
1ut7_A2e-51115715169NO APICAL MERISTEM PROTEIN
1ut7_B2e-51115715169NO APICAL MERISTEM PROTEIN
3swm_A3e-51115718172NAC domain-containing protein 19
3swm_B3e-51115718172NAC domain-containing protein 19
3swm_C3e-51115718172NAC domain-containing protein 19
3swm_D3e-51115718172NAC domain-containing protein 19
3swp_A3e-51115718172NAC domain-containing protein 19
3swp_B3e-51115718172NAC domain-containing protein 19
3swp_C3e-51115718172NAC domain-containing protein 19
3swp_D3e-51115718172NAC domain-containing protein 19
4dul_A2e-51115715169NAC domain-containing protein 19
4dul_B2e-51115715169NAC domain-containing protein 19
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025792378.11e-156NAC domain-containing protein 71-like
TrEMBLA0A2T7C9T31e-155A0A2T7C9T3_9POAL; Uncharacterized protein
STRINGPavir.Ia03491.1.p1e-154(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP62093854