PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc00218.1.g00340.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family NAC
Protein Properties Length: 423aa    MW: 46833.3 Da    PI: 7.3513
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc00218.1.g00340.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM162.71.3e-501612891128
                           NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksg 81 
                                   lppGfrF P+deelv++yL kkv+++++    ++ evd++  ePw+Lp  +k + +ewyfFs rd+kyatg+r+nratk+g
  Zmw_sc00218.1.g00340.1.am.mk 161 LPPGFRFYPSDEELVCHYLYKKVANERIAQ-GTLVEVDLHAREPWELPDVAKLTASEWYFFSFRDRKYATGSRTNRATKTG 240
                                   79*************************998.88***************77777889************************* PP

                           NAM  82 yWkatgkdkevlsk..kgelvglkktLvfykgrapkgektdWvmheyrl 128
                                   yWkatgkd+ev s   ++++vg++ktLvfy+grap+g+k+ Wvmhe+rl
  Zmw_sc00218.1.g00340.1.am.mk 241 YWKATGKDREVRSPasTRAVVGMRKTLVFYQGRAPNGVKSGWVMHEFRL 289
                                   ************99777788***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.75E-60155308IPR003441NAC domain
PROSITE profilePS5100558.558161308IPR003441NAC domain
PfamPF023651.3E-27162289IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 423 aa     Download sequence    Send to blast
MYGADRSING QTVDFLSRSV ACGAGTLHII SASRYSTHTR ASGKLALDHV WSRSIDAAWL  60
GNLPGRVWLC EADDARCRCR CSCTTLARFQ YSARPAVRAT EMAARYWNLS TWLRSVSVVA  120
SADGDLTAAR HVSSRPADQL DKVATPRRQD EVLDSMIEST LPPGFRFYPS DEELVCHYLY  180
KKVANERIAQ GTLVEVDLHA REPWELPDVA KLTASEWYFF SFRDRKYATG SRTNRATKTG  240
YWKATGKDRE VRSPASTRAV VGMRKTLVFY QGRAPNGVKS GWVMHEFRLD APHSQPREDW  300
VLCRVFQKTK GDGDGQVDSA CGASSPTLTG SSHAMPEQEH HHAAPCGYYG PGFLPQQEVA  360
VLPYYDGPAV DRHGFPQDDA GGALPGLEFG ARGVAGDEYG FGWFDMAGFD EMTTNHGFPQ  420
GWN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A3e-4815430810165NO APICAL MERISTEM PROTEIN
1ut4_B3e-4815430810165NO APICAL MERISTEM PROTEIN
1ut7_A3e-4815430810165NO APICAL MERISTEM PROTEIN
1ut7_B3e-4815430810165NO APICAL MERISTEM PROTEIN
4dul_A3e-4815430810165NAC domain-containing protein 19
4dul_B3e-4815430810165NAC domain-containing protein 19
Search in ModeBase
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Repressed post-transcriptionally by miR164. {ECO:0000269|PubMed:15294871, ECO:0000269|PubMed:17098808, ECO:0000269|PubMed:18305205, ECO:0000305|PubMed:15723790}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002452475.11e-120NAC domain-containing protein 100
SwissprotQ9FLR33e-59NAC79_ARATH; NAC domain-containing protein 79
TrEMBLC5XXS91e-119C5XXS9_SORBI; Uncharacterized protein
STRINGSb04g026440.11e-119(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP69738166
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Vidal EA,Álvarez JM,Gutiérrez RA
    Nitrate regulation of AFB3 and NAC4 gene expression in Arabidopsis roots depends on NRT1.1 nitrate transport function.
    Plant Signal Behav, 2014. 9(3): p. e28501
    [PMID:24642706]
  4. Lee MH,Jeon HS,Kim HG,Park OK
    An Arabidopsis NAC transcription factor NAC4 promotes pathogen-induced cell death under negative regulation by microRNA164.
    New Phytol., 2017. 214(1): p. 343-360
    [PMID:28032643]