PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc00214.1.g00080.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family NAC
Protein Properties Length: 299aa    MW: 33546.1 Da    PI: 7.8577
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc00214.1.g00080.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM165.42e-51141461128
                             NAM   1 lppGfrFhPtdeelvveyLkkkvegkk....lelee....vikevdiykvePwdLpkkvkaeekewyfFskrdkkyatg 71 
                                     lppGfrFhP+d+elv +yL+kk++g      ++       ++ +vd++k+ePwdLp  +  + kewyf+s rd+kyatg
  Zmw_sc00214.1.g00080.1.am.mkhc  14 LPPGFRFHPQDDELVLDYLAKKLHGGGgslvVT--IygcpTMVDVDLNKCEPWDLPDIACIGGKEWYFYSLRDRKYATG 90 
                                     79**********************999776522..13443699*************6555689**************** PP

                             NAM  72 krknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                                     +r+nrat+sgyWkatgkd+++ + kg lvg++ktLvfy+grapkg+kt+Wvmhe+r+
  Zmw_sc00214.1.g00080.1.am.mkhc  91 QRTNRATESGYWKATGKDRPISR-KGLLVGMRKTLVFYQGRAPKGKKTEWVMHEFRM 146
                                     *********************99.999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.23E-614169IPR003441NAC domain
PROSITE profilePS5100555.3914169IPR003441NAC domain
PfamPF023651.0E-2515146IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 299 aa     Download sequence    Send to blast
MAVMNSLSMV EARLPPGFRF HPQDDELVLD YLAKKLHGGG GSLVVTIYGC PTMVDVDLNK  60
CEPWDLPDIA CIGGKEWYFY SLRDRKYATG QRTNRATESG YWKATGKDRP ISRKGLLVGM  120
RKTLVFYQGR APKGKKTEWV MHEFRMEGQG DPTKVPFKED WVLCRVFYKS RATIAKPSPE  180
SSSYNVDTST TSLPPLIDNY NISFGQPAGS VQNLEGYDQV PCFSNNPSQP PSSMNVPMPS  240
AMAADQEQHM GKSIKDVLMS QLSRFEGNVK TEAPQSKFPQ DGFEYLAESG FTQMWNSFN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A9e-501017011169Stress-induced transcription factor NAC1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that mediates auxin signaling to promote lateral root development. Activates the expression of two downstream auxin-responsive genes, DBP and AIR3. {ECO:0000269|PubMed:11114891}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by auxin.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_022681432.10.0NAC domain-containing protein 21/22
SwissprotQ84TE62e-87NAC22_ARATH; NAC domain-containing protein 21/22
TrEMBLA0A1E5VPB20.0A0A1E5VPB2_9POAL; NAC domain-containing protein 21/22
STRINGPavir.J36955.1.p0.0(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP101237138
Publications ? help Back to Top
  1. Le Hénanff G, et al.
    Grapevine NAC1 transcription factor as a convergent node in developmental processes, abiotic stresses, and necrotrophic/biotrophic pathogen tolerance.
    J. Exp. Bot., 2013. 64(16): p. 4877-93
    [PMID:24043850]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Xiao D, et al.
    SENESCENCE-SUPPRESSED PROTEIN PHOSPHATASE Directly Interacts with the Cytoplasmic Domain of SENESCENCE-ASSOCIATED RECEPTOR-LIKE KINASE and Negatively Regulates Leaf Senescence in Arabidopsis.
    Plant Physiol., 2015. 169(2): p. 1275-91
    [PMID:26304848]
  4. Huo X,Wang C,Teng Y,Liu X
    Identification of miRNAs associated with dark-induced senescence in Arabidopsis.
    BMC Plant Biol., 2015. 15: p. 266
    [PMID:26530097]
  5. Chen X, et al.
    Auxin-Independent NAC Pathway Acts in Response to Explant-Specific Wounding and Promotes Root Tip Emergence during de Novo Root Organogenesis in Arabidopsis.
    Plant Physiol., 2016. 170(4): p. 2136-45
    [PMID:26850273]
  6. Liu C,Wang B,Li Z,Peng Z,Zhang J
    TsNAC1 Is a Key Transcription Factor in Abiotic Stress Resistance and Growth.
    Plant Physiol., 2018. 176(1): p. 742-756
    [PMID:29122985]