PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc00209.1.g00320.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family bZIP
Protein Properties Length: 382aa    MW: 40840.6 Da    PI: 8.1283
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc00209.1.g00320.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_132.51.9e-10213265557
                                     CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                          bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkeva 57 
                                     kr++r   NR +A rs +RK +++ eLe+k ++L++e ++L  +l  l+  + 
  Zmw_sc00209.1.g00320.1.sm.mkhc 213 KRAKRILANRQSAARSKERKMKYTSELERKLQTLQTEATTLSAQLTLLQLVYH 265
                                     9*****************************************99998876555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003384.4E-12209273IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.921211274IPR004827Basic-leucine zipper domain
PfamPF001703.6E-9213261IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.06E-10213269No hitNo description
Gene3DG3DSA:1.20.5.1706.3E-10213262No hitNo description
CDDcd147031.46E-22214261No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 382 aa     Download sequence    Send to blast
MKLPSHPCSF PRAPSAPVHR AHGPPTPSGP GELAALLSQR ELAASRSGCS PDVCRAPARA  60
LTFIRLPDAD LLLDPDGDFF SDLDFPSLSD DSAAASDPAP PPPLQQQQQQ QQQQASSPAP  120
PWPRGGGGGG GAHMRSLSFD AALFDGLSLQ QGGGGGGGGG GSGRAAGHKR SGSVDGPGSP  180
FEGESALSGV LPDYAKKAVP AEKFAEVALL DPKRAKRILA NRQSAARSKE RKMKYTSELE  240
RKLQTLQTEA TTLSAQLTLL QLVYHVVKDE IRDTSGLTTE NRELKLRLQA MEEQAKLRDA  300
LNDALREEVQ RLKIAAGQVP NMNGNPFNGG LPQQQQQMAS YFSQPQQMQY FGGHQIQHHR  360
PNHQPQNSSN GGRSLNDSMD FV
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001151391.21e-144transcription factor RF2b
TrEMBLA0A1D6EHU01e-142A0A1D6EHU0_MAIZE; Transcription factor VIP1
TrEMBLA0A3L6FZV11e-142A0A3L6FZV1_MAIZE; Transcription factor VIP1
STRINGPavir.Ha01827.1.p1e-144(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP19253892