PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc00195.1.g00070.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family NAC
Protein Properties Length: 399aa    MW: 43722.8 Da    PI: 7.1636
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc00195.1.g00070.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM163.67.3e-51171451128
                             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratk 79 
                                     lp+GfrFhPtdeel+v+yL ++++  ++++  +i+ev+iy+++PwdLp+k+  +e+ewyfFs+rd+ky++g+r+nra+ 
  Zmw_sc00195.1.g00070.1.sm.mkhc  17 LPAGFRFHPTDEELIVHYLMNQAACIPCPV-PIIAEVNIYECNPWDLPRKAVFGENEWYFFSPRDRKYPNGSRPNRAAG 94 
                                     799***************************.88***************8777899************************ PP

                             NAM  80 sgyWkatgkdkevlsk..kgelvglkktLvfykgrapkgektdWvmheyrl 128
                                     +gyWkatg+dk+v+++  +ge+vg+kk Lvfy gr p+g+ktdW+mheyrl
  Zmw_sc00195.1.g00070.1.sm.mkhc  95 NGYWKATGTDKAVVAAasTGETVGVKKALVFYMGRPPRGVKTDWIMHEYRL 145
                                     **************98888999***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.32E-639176IPR003441NAC domain
PROSITE profilePS5100557.89217176IPR003441NAC domain
PfamPF023651.8E-2518145IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 399 aa     Download sequence    Send to blast
MANSRSSSSS CRTMPSLPAG FRFHPTDEEL IVHYLMNQAA CIPCPVPIIA EVNIYECNPW  60
DLPRKAVFGE NEWYFFSPRD RKYPNGSRPN RAAGNGYWKA TGTDKAVVAA ASTGETVGVK  120
KALVFYMGRP PRGVKTDWIM HEYRLTVGNG KTTRRAAGSS SSMRLDDWVL CRIHKKSNNF  180
QFSDQEQEGS SIVEEADSSL NNTNMNTNGG APSPASEQAS HASDAGDHQF QLPPRLPKSC  240
SLTDLLNSID YSALSQLLLD APAEPEPEPQ PQQQQGQSPL IYYATPACPQ PQLLKSSLNV  300
SQLQVDALFS DYSAGYYSRS SGLKRKRSSC DDGSSSRRKL QLLPSEATFF GSASGYCNQQ  360
LAEAASSSGG GFQYSGLLSH PLLNQQQLLL NSHLEMQMQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A2e-731618114173Stress-induced transcription factor NAC1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025828039.11e-146NAC transcription factor 29-like
TrEMBLA0A2T7CJJ91e-145A0A2T7CJJ9_9POAL; Uncharacterized protein
STRINGSi026530m1e-140(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP38033775