PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc00195.1.g00030.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family ZF-HD
Protein Properties Length: 203aa    MW: 21596.2 Da    PI: 8.8768
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc00195.1.g00030.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer98.54.9e-31134189258
                   ZF-HD_dimer   2 ekvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreve 58 
                                   + v+Y+eC++NhAas+GghavDGC+Efm+  g++gta+al CaAC CHR+FHRreve
  Zmw_sc00195.1.g00030.1.am.mk 134 KVVHYRECQRNHAASIGGHAVDGCREFMAL-GADGTADALVCAACSCHRSFHRREVE 189
                                   5799*************************9.999********************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257744.0E-19132189IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047701.4E-28136188IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015662.3E-25137188IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152325.696138187IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Sequence ? help Back to Top
Protein Sequence    Length: 203 aa     Download sequence    Send to blast
MERSGAGKRT EKSRTAPTPT KFAVLQPATT LAGKKLLDAF NRTQHLEGAG QASQFIIMQN  60
HTNNWWGTFA SSNGAQPGRA FSSSFLPVSP HQLPFLLVLE APQSPPPTTA TTATMGPKQD  120
PPTANGTATR KETKVVHYRE CQRNHAASIG GHAVDGCREF MALGADGTAD ALVCAACSCH  180
RSFHRREVEV AECSSTTTTT TSG
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLK3ZLE63e-43K3ZLE6_SETIT; Uncharacterized protein
STRINGSi027403m8e-43(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP143134120