PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc00180.1.g00450.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family LBD
Protein Properties Length: 415aa    MW: 44824.6 Da    PI: 5.2309
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc00180.1.g00450.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260117.67.7e-37541541101
                        DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvil 81 
                                   aCaaCk++rrkC+++C la+ fpa+q++ f  +h+lFG+sn++k+l++++ e  ++am++l++eAeara dPvyG++g+i+
  Zmw_sc00180.1.g00450.1.sm.mk  54 ACAACKYQRRKCNPECRLARFFPADQKRLFLHAHRLFGVSNIQKTLRRTDAEYEQEAMRALIFEAEARAGDPVYGCFGIIR 134
                                   7******************************************************************************** PP

                        DUF260  82 klqqqleqlkaelallkeel 101
                                   klqqq++   a+l++l++++
  Zmw_sc00180.1.g00450.1.sm.mk 135 KLQQQIAVGTAQLDALHQQI 154
                                   ***************99986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089122.42353154IPR004883Lateral organ boundaries, LOB
PfamPF031952.8E-3454151IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 415 aa     Download sequence    Send to blast
MSPTSNSSKP PRSHLRQVDK TTTGSAASPL GPPSRNHSAP SPSAAAGNGG QSQACAACKY  60
QRRKCNPECR LARFFPADQK RLFLHAHRLF GVSNIQKTLR RTDAEYEQEA MRALIFEAEA  120
RAGDPVYGCF GIIRKLQQQI AVGTAQLDAL HQQIAMYRQA AAAGGFDPPA NGTAVLAAPG  180
QDNVSMSMDA YFGGGAEHVP VHQTGAEHVP VHQTGAEHVP IHQTGAEHVP VHQTGAGFVD  240
VRDQQQQQHY NALEAIDDHQ DYQKAPFNGF CYDGTARDEL ASGDGRAVQE YCYSDASLKA  300
GAPAQLTSLE EQLENHFQND EACFVDGIDV KPQDLPGTMM AEHYDGHGGV EQPMENKIAA  360
EAVNYDADQM AGLLKYDADQ MAGLLKYDAD QMAEPAAPAT MQRELEQLGF TSSSF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A1e-24441571114LOB family transfactor Ramosa2.1
5ly0_B1e-24441571114LOB family transfactor Ramosa2.1
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP52283461