PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc00172.1.g00160.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family SRS
Protein Properties Length: 255aa    MW: 25942.6 Da    PI: 6.8338
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc00172.1.g00160.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF70231.26.8e-1096117425
                          DUF702   4 gtasCqdCGnqakkdCaheRCR 25 
                                     g++sCqdCGnqakkdCah+RCR
  Zmw_sc00172.1.g00160.1.sm.mkhc  96 GGVSCQDCGNQAKKDCAHQRCR 117
                                     6789*****************9 PP

2DUF70276.38.9e-2411917596152
                          DUF702  96 skkeletsslPeevsseavfrcvrvssvddgeeelaYqtavsigGhvfkGiLydqGl 152
                                     +++ + ++++P+evsse vfrcvr++ vd++++e+aYqt+vsigGhvfkGiL+d G+
  Zmw_sc00172.1.g00160.1.sm.mkhc 119 QQMVTVAERFPREVSSETVFRCVRLGPVDQADAEVAYQTSVSIGGHVFKGILQDVGP 175
                                     566778899***********************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051421.4E-697117IPR007818Protein of unknown function DUF702
PfamPF051421.4E-20124175IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016246.3E-20127175IPR006511Lateral Root Primordium type 1, C-terminal
Sequence ? help Back to Top
Protein Sequence    Length: 255 aa     Download sequence    Send to blast
MAGFPLGGGG HHSRDEPAPS VPQVHPSDAA SFLYAARGGG GLQLWQQHEH QHPFYASNVI  60
RFSSDDSPGA APLLTGAAAS SSSSRGARGS GGAVGGGVSC QDCGNQAKKD CAHQRCRDQQ  120
MVTVAERFPR EVSSETVFRC VRLGPVDQAD AEVAYQTSVS IGGHVFKGIL QDVGPTCLAS  180
VGGSGSGPAI EYHHFRHAGD GSPPSTTPAG EAGGGGGVAG NIIVSSAVVM DPYPTPGPYG  240
AFPAGMSFFH GHPRP
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025803795.18e-58protein SHI RELATED SEQUENCE 1-like
TrEMBLA0A0A9DX084e-59A0A0A9DX08_ARUDO; Uncharacterized protein
STRINGPavir.J34076.1.p6e-62(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP135435124