PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc00164.1.g00120.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family NAC
Protein Properties Length: 281aa    MW: 31014 Da    PI: 5.1783
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc00164.1.g00120.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM158.92e-49111411129
                           NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksg 81 
                                   lppGfrF P+deelv++yL kkv+++++    ++ evd++  ePw+Lp  +k + +ewyfFs rd+kyatg+r+nratk+g
  Zmw_sc00164.1.g00120.1.am.mk  11 LPPGFRFCPSDEELVSFYLLKKVANERVAS-GTLVEVDLHAREPWELPDVAKLTAEEWYFFSFRDRKYATGSRTNRATKTG 90 
                                   79*************************888.88***************77777889************************* PP

                           NAM  82 yWkatgkdkevlsk...kgelvglkktLvfykgrapkgektdWvmheyrle 129
                                   yWkatgkd+ v +    +++ vg++ktLvfy grap+g+kt+Wvmhe+rle
  Zmw_sc00164.1.g00120.1.am.mk  91 YWKATGKDRVVREPgpgTRAIVGMRKTLVFYLGRAPNGQKTSWVMHEFRLE 141
                                   ***********9998877788***************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.89E-598159IPR003441NAC domain
PROSITE profilePS5100557.56811159IPR003441NAC domain
PfamPF023651.7E-2712140IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 281 aa     Download sequence    Send to blast
MGLITGMDAA LPPGFRFCPS DEELVSFYLL KKVANERVAS GTLVEVDLHA REPWELPDVA  60
KLTAEEWYFF SFRDRKYATG SRTNRATKTG YWKATGKDRV VREPGPGTRA IVGMRKTLVF  120
YLGRAPNGQK TSWVMHEFRL ETPNTLPKED WVLCRVFNKT KPTEETQQSS SGALHHNHGA  180
ATLLSALQPA DTTPAVSCSG SSDAWLTNLP VLNLNQDSFL DFCSPVVHGE LAVEPHNAAI  240
AMAPEPAVGF EDHDMGDIET EYDPQALLLG SCCYGDVGIY F
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A9e-491016516171NO APICAL MERISTEM PROTEIN
1ut4_B9e-491016516171NO APICAL MERISTEM PROTEIN
1ut7_A9e-491016516171NO APICAL MERISTEM PROTEIN
1ut7_B9e-491016516171NO APICAL MERISTEM PROTEIN
4dul_A9e-491016516171NAC domain-containing protein 19
4dul_B9e-491016516171NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator. Involved in molecular mechanisms regulating shoot apical meristem (SAM) formation during embryogenesis and organ separation. Required for axillary meristem initiation and separation of the meristem from the main stem. May act as an inhibitor of cell division. {ECO:0000269|PubMed:12837947, ECO:0000269|PubMed:17122068}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By BRM, at the chromatin level, and conferring a very specific spatial expression pattern. {ECO:0000269|PubMed:16854978}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025796946.11e-116protein CUP-SHAPED COTYLEDON 3-like
SwissprotQ9S8514e-59NAC31_ARATH; Protein CUP-SHAPED COTYLEDON 3
TrEMBLA0A2S3ILI11e-115A0A2S3ILI1_9POAL; Uncharacterized protein
STRINGSi036835m1e-115(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP69738166
Publications ? help Back to Top
  1. Chen C, et al.
    Transcriptome profiling reveals roles of meristem regulators and polarity genes during fruit trichome development in cucumber (Cucumis sativus L.).
    J. Exp. Bot., 2014. 65(17): p. 4943-58
    [PMID:24962999]
  2. Gonçalves B, et al.
    A conserved role for CUP-SHAPED COTYLEDON genes during ovule development.
    Plant J., 2015. 83(4): p. 732-42
    [PMID:26119568]
  3. Balkunde R,Kitagawa M,Xu XM,Wang J,Jackson D
    SHOOT MERISTEMLESS trafficking controls axillary meristem formation, meristem size and organ boundaries in Arabidopsis.
    Plant J., 2017. 90(3): p. 435-446
    [PMID:28161901]
  4. Espinosa-Ruiz A, et al.
    TOPLESS mediates brassinosteroid control of shoot boundaries and root meristem development in Arabidopsis thaliana.
    Development, 2017. 144(9): p. 1619-1628
    [PMID:28320734]
  5. Koyama T,Sato F,Ohme-Takagi M
    Roles of miR319 and TCP Transcription Factors in Leaf Development.
    Plant Physiol., 2017. 175(2): p. 874-885
    [PMID:28842549]