PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc00159.1.g00420.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family G2-like
Protein Properties Length: 564aa    MW: 60948 Da    PI: 9.3481
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc00159.1.g00420.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like100.11.5e-31262317156
                       G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                                   k+r++W+peLH+rFv+a++ LGG+++AtPk+i+elmkv+gLt+++vkSHLQkYRl+
  Zmw_sc00159.1.g00420.1.am.mk 262 KARRCWSPELHRRFVNALQILGGAQVATPKQIRELMKVDGLTNDEVKSHLQKYRLH 317
                                   68****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.69259319IPR017930Myb domain
SuperFamilySSF466895.32E-17259320IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.2E-28260320IPR009057Homeodomain-like
TIGRFAMsTIGR015573.4E-26262317IPR006447Myb domain, plants
PfamPF002491.3E-6264315IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009266Biological Processresponse to temperature stimulus
GO:0009740Biological Processgibberellic acid mediated signaling pathway
GO:0010452Biological Processhistone H3-K36 methylation
GO:0048579Biological Processnegative regulation of long-day photoperiodism, flowering
GO:1903507Biological Processnegative regulation of nucleic acid-templated transcription
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 564 aa     Download sequence    Send to blast
MSSSSPSDLT LDYKPNGGAY AAIPKQQQAP PLVDGHHLTT EPASQKLREF LARLEEERLK  60
IDAFKRELPL CMQLLNHAME AYKQQLEAYQ MGSQQAVATR PLVLEEFIPL KNIGIDAVTD  120
KPGNPPSEKA TWMESAQLWN GPAADTAAKG PQTPKERSEH PLPIDTLGTL DGRRSGGAFL  180
PFAKDKSAVP DAATALPELA LAPAEKDAVA EVDRKSPYLD AAGGGNNGVL GALRDTQNGG  240
VKPTSAAPEG QASPAPPQTH RKARRCWSPE LHRRFVNALQ ILGGAQVATP KQIRELMKVD  300
GLTNDEVKSH LQKYRLHTRR PPAPPNPATA APQLVVLGGI WVPPEYAAQG TAPAIYGAHP  360
ATQPHYTAAV AAQEYYPSPA AWQGQMHLLL CVHVSSRAVV AGATCHGLPR NDSCRVVSAI  420
AVYIKAHTEV MPYVSMVMLG SRARRPCSRA SRRAPGTAHR RRPVREEGWY MDARGKTHAL  480
REWAVTLEED IGLAQGGRRV RAAAAELQDH QQDGQDAAQE AAAPRVQGVR AAAVHDMSSA  540
NFEVEGAVRR DEGAVRRERG RRPA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A3e-14262315255Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B3e-14262315255Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A3e-14262315154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B3e-14262315154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C3e-14262315154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D3e-14262315154Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A3e-14262315255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C3e-14262315255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D3e-14262315255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F3e-14262315255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H3e-14262315255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J3e-14262315255Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1548562RRDEGAVRRERGRRP
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that may play a role in regulatory networks controlling development and metabolism. {ECO:0000250|UniProtKB:Q6Z869}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00261DAPTransfer from AT2G03500Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002457252.10.0transcription factor NIGTH1
SwissprotQ5VRW21e-140NOH1_ORYSJ; Transcription factor NIGTH1
TrEMBLA0A3L6SLE00.0A0A3L6SLE0_PANMI; Putative transcription factor GLK2
STRINGSb03g004090.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP97733338
Publications ? help Back to Top
  1. Kamrul Huda KM, et al.
    Salinity and drought tolerant OsACA6 enhances cold tolerance in transgenic tobacco by interacting with stress-inducible proteins.
    Plant Physiol. Biochem., 2014. 82: p. 229-38
    [PMID:24992889]