PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc00145.1.g00130.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family NAC
Protein Properties Length: 410aa    MW: 44063 Da    PI: 6.8731
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc00145.1.g00130.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM168.81.8e-52111391128
                           NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvka.eekewyfFskrdkkyatgkrknrat 78 
                                   +ppGfrFhPt+eel+++yL+kkv++++++l +vi++vd++k+ePwd+++  k+ +  +++wyfFs++dkky+tg+r+nrat
  Zmw_sc00145.1.g00130.1.sm.mk  11 VPPGFRFHPTEEELLDYYLRKKVASQEIDL-DVIRDVDLNKLEPWDIQEkcKIGSgPQNDWYFFSHKDKKYPTGTRTNRAT 90 
                                   69****************************.9***************952444443456********************** PP

                           NAM  79 ksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                                   ++g+Wkatg+dk++++   + +g++ktLvfykgrap+g+k+dW+mheyrl
  Zmw_sc00145.1.g00130.1.sm.mk  91 AAGFWKATGRDKAIYN-AVKRIGMRKTLVFYKGRAPHGQKSDWIMHEYRL 139
                                   ****************.8899***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019418.5E-557149IPR003441NAC domain
PROSITE profilePS5100554.00311213IPR003441NAC domain
PfamPF023655.4E-2812139IPR003441NAC domain
SuperFamilySSF1019418.5E-55201213IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 410 aa     Download sequence    Send to blast
MSISVNGQSC VPPGFRFHPT EEELLDYYLR KKVASQEIDL DVIRDVDLNK LEPWDIQEKC  60
KIGSGPQNDW YFFSHKDKKY PTGTRTNRAT AAGFWKATGR DKAIYNAVKR IGMRKTLVFY  120
KGRAPHGQKS DWIMHEYRLD DPANADATAA TVELLQPSFI PSIGCNNVLT PAFASLVGDA  180
VIHGQDRQVT AAVAASSDAG QEDGWVVCRV FKKKHHHKES GSDGRGKHGH DHGRGNNGSK  240
AATHGHELQY SSNNDALDQI LSPPGGPGRP GSRYLQPIET VLGGQGFMKL PPLESPLAAT  300
TALTPPPHMP GKAAASSGGD DLLHRGGNRI TDWAMMDRLV ASHLNGQPDA PADHQLGSFD  360
GGDDVGSADV LAFYSAAATR LFSGGGGGSD ASGSDDDLWS FARSAERLIG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A5e-44814914152NO APICAL MERISTEM PROTEIN
1ut4_B5e-44814914152NO APICAL MERISTEM PROTEIN
1ut7_A5e-44814914152NO APICAL MERISTEM PROTEIN
1ut7_B5e-44814914152NO APICAL MERISTEM PROTEIN
4dul_A5e-44814914152NAC domain-containing protein 19
4dul_B5e-44814914152NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator of genes involved in biosynthesis of secondary walls. Together with NST2 and NST3, required for the secondary cell wall thickening of sclerenchymatous fibers, secondary xylem (tracheary elements), and of the anther endocethium, which is necessary for anther dehiscence. May also regulate the secondary cell wall lignification of other tissues. {ECO:0000269|PubMed:16214898, ECO:0000269|PubMed:17237351, ECO:0000269|PubMed:17333250}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001140582.11e-162uncharacterized protein LOC100272652
SwissprotQ84WP61e-107NAC43_ARATH; NAC domain-containing protein 43
TrEMBLA0A3L6F7521e-162A0A3L6F752_MAIZE; NAC domain-containing protein 43
STRINGGRMZM2G069047_P011e-161(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP159738112
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Gondolf VM, et al.
    A gene stacking approach leads to engineered plants with highly increased galactan levels in Arabidopsis.
    BMC Plant Biol., 2014. 14: p. 344
    [PMID:25492673]
  3. Jaradat MR,Ruegger M,Bowling A,Butler H,Cutler AJ
    A comprehensive transcriptome analysis of silique development and dehiscence in Arabidopsis and Brassica integrating genotypic, interspecies and developmental comparisons.
    GM Crops Food, 2014. 5(4): p. 302-20
    [PMID:25523176]
  4. Yuan Y,Teng Q,Zhong R,Ye ZH
    TBL3 and TBL31, Two Arabidopsis DUF231 Domain Proteins, are Required for 3-O-Monoacetylation of Xylan.
    Plant Cell Physiol., 2016. 57(1): p. 35-45
    [PMID:26556650]
  5. Yang C, et al.
    Transcription Factor MYB26 Is Key to Spatial Specificity in Anther Secondary Thickening Formation.
    Plant Physiol., 2017. 175(1): p. 333-350
    [PMID:28724622]
  6. Pascual MB, et al.
    PpNAC1, a main regulator of phenylalanine biosynthesis and utilization in maritime pine.
    Plant Biotechnol. J., 2018. 16(5): p. 1094-1104
    [PMID:29055073]
  7. Liu C,Yu H,Li L
    SUMO modification of LBD30 by SIZ1 regulates secondary cell wall formation in Arabidopsis thaliana.
    PLoS Genet., 2019. 15(1): p. e1007928
    [PMID:30657769]