PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc00123.1.g00100.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family SBP
Protein Properties Length: 472aa    MW: 50276.8 Da    PI: 6.889
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc00123.1.g00100.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP125.71.9e-39185262178
                                   --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
                           SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                                   +Cq+egC+adl+ ak+yhrrhkvCe h+ka++v++ g++qrfCqqCsrfh l efDe+krsCr+rL +hn+rrrk+++
  Zmw_sc00123.1.g00100.1.am.mk 185 RCQAEGCKADLTAAKHYHRRHKVCEYHAKAAAVAAGGKQQRFCQQCSRFHVLVEFDESKRSCRKRLTEHNRRRRKPAS 262
                                   6**************************************************************************875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.102.6E-33178247IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.923183260IPR004333Transcription factor, SBP-box
SuperFamilySSF1036124.45E-37184263IPR004333Transcription factor, SBP-box
PfamPF031106.8E-30186259IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 472 aa     Download sequence    Send to blast
MSPPPYLGFF DAGNMPMPSL ERPLLGLGHQ QHNNHYDDFD CAASFPFQDS SFLLPPTTSL  60
PPAPPLLTMD MAMAPTSPSS MHQMTLPCVP AEELYHPAFG VGSSPFLKRE DGPVVDAGGG  120
KIGLNLGRRT YFSTADVLAV DRLLLTRSPL GGGGGVGAGL GLGLGMAGVL GLGLRAPHHH  180
HQPPRCQAEG CKADLTAAKH YHRRHKVCEY HAKAAAVAAG GKQQRFCQQC SRFHVLVEFD  240
ESKRSCRKRL TEHNRRRRKP ASEQGDKEDS SPPPKRADTT SYSSDHKSAS PAAAKSTAIS  300
PNGSGVSCLD MDNNGQMMIS SAAAAAPTAR SLSALPLGKD GDLDTMLMMR QVHDGDEEQQ  360
RFVTSLVLQA QQHHHNGGVG NVLSTLSCSP VPDQHQNGDC NGFFETHQIP YLYPVALLPS  420
DEISSPATNL VSCFAPLYGE QCPAPLDCNP PFPCAASCPV SSFPCAASGP EI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-271862591184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1242259KRSCRKRLTEHNRRRRKP
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3'. {ECO:0000250}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002451645.21e-123squamosa promoter-binding-like protein 5
SwissprotQ0E3F81e-53SPL5_ORYSJ; Squamosa promoter-binding-like protein 5
TrEMBLA0A1Z5RL611e-122A0A1Z5RL61_SORBI; Uncharacterized protein
STRINGSb04g005180.11e-122(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23753593