PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc00105.1.g00420.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family NAC
Protein Properties Length: 321aa    MW: 35933.7 Da    PI: 6.4096
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc00105.1.g00420.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM156.89.1e-49131393128
                             NAM   3 pGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksg 81 
                                     pGfrFhPt+eel+++yL+  v+gkkl++ ++i +++iy+++PwdLp+++k +e+ewyfF++rd+k+ +g r+nr+t++g
  Zmw_sc00105.1.g00420.1.sm.mkhc  13 PGFRFHPTEEELLDFYLHSVVHGKKLNF-DIIGTLNIYRHDPWDLPRMAKIGEREWYFFVPRDRKAGSGGRPNRTTEHG 90 
                                     9*************************99.99***************988999*************************** PP

                             NAM  82 yWkatgkdkevlsk..kgelvglkktLvfykgrapkgektdWvmheyrl 128
                                     +Wkatg+d+++ s+   ++++glkktLvfykgrap+g+ktdWvm eyrl
  Zmw_sc00105.1.g00420.1.sm.mkhc  91 FWKATGSDRAIRSSadAKRVIGLKKTLVFYKGRAPRGTKTDWVMSEYRL 139
                                     ************99777888***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.12E-554166IPR003441NAC domain
PROSITE profilePS5100553.67911166IPR003441NAC domain
PfamPF023652.5E-2413139IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009965Biological Processleaf morphogenesis
GO:0010200Biological Processresponse to chitin
GO:0045792Biological Processnegative regulation of cell size
GO:0048281Biological Processinflorescence morphogenesis
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 321 aa     Download sequence    Send to blast
MATASMEMEQ DLPGFRFHPT EEELLDFYLH SVVHGKKLNF DIIGTLNIYR HDPWDLPRMA  60
KIGEREWYFF VPRDRKAGSG GRPNRTTEHG FWKATGSDRA IRSSADAKRV IGLKKTLVFY  120
KGRAPRGTKT DWVMSEYRLP EFGFAVRGAA PAPPKEDIVL CKVYRKATPL KELEQRATEM  180
EERQRCSNLD YMTRASLVGV SPSAGDDYLS PDDVHDSFLV LSSSSSEPSE DSNNATMAAK  240
KEADATVTLA ASSLPPLQQI AATPAAVNMP SMQLPTVTHG DLPSLQVPAN NGVFDWMQDP  300
FQLRSTWQDQ FFLSPLANLL Y
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A4e-47716610168Stress-induced transcription factor NAC1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that binds sequence-specific DNA motifs. Involved in stress response. Plays a positive role in drought and salt stress tolerance through the modulation of abscisic acid-mediated signaling. {ECO:0000269|PubMed:26834774}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by drought stress, salt stress and abscisic acid (ABA). {ECO:0000269|PubMed:26834774}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025795753.11e-163NAC domain-containing protein 22
SwissprotQ10S651e-138NAC22_ORYSJ; NAC domain-containing protein 22
TrEMBLA0A3L6S6V01e-164A0A3L6S6V0_PANMI; NAC domain-containing protein 67-like
STRINGPavir.J24394.1.p1e-159(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP177038105
Publications ? help Back to Top
  1. Hong Y,Zhang H,Huang L,Li D,Song F
    Overexpression of a Stress-Responsive NAC Transcription Factor Gene ONAC022 Improves Drought and Salt Tolerance in Rice.
    Front Plant Sci, 2016. 7: p. 4
    [PMID:26834774]