PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc00105.1.g00270.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family Nin-like
Protein Properties Length: 555aa    MW: 62248.9 Da    PI: 4.7642
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc00105.1.g00270.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK88.17.1e-28438488252
                          RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                                     ek++sledl+k+F++++k+AAk+L vc+T+LKriCRq+GI+RWP+Rkik++
  Zmw_sc00105.1.g00270.1.sm.mkhc 438 EKTVSLEDLRKHFAGSLKEAAKNLRVCPTTLKRICRQHGINRWPSRKIKKV 488
                                     799**********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151915.903427508IPR003035RWP-RK domain
PfamPF020428.2E-26440488IPR003035RWP-RK domain
SMARTSM006669.7E-6480552IPR000270PB1 domain
PROSITE profilePS5174515.296480555IPR000270PB1 domain
SuperFamilySSF542778.18E-14497552No hitNo description
Gene3DG3DSA:3.10.20.2404.3E-14498553No hitNo description
PfamPF005641.8E-10499551IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 555 aa     Download sequence    Send to blast
MEQKEEDGFL GCGTRMEEEI VVGDMDLMEE LFLAAPGFDF SDFPNPGAGA SPAAAAAFSP  60
LFDICSTTTT ATPPPAQAGE DDREEPAEKA DREGANTPLR PWLFQPRQQE VEATVKERLR  120
RALERIASLS QSQPGELLAQ VWVPTVIGDR QVLTTCGQPF WLDRRNERLA SYRTVSMKYQ  180
FSADESSRAE LGLPGRVFVG RVPEWTPDVR YFSTEEYPRV RHAQHFDIRG SVALPIFEPC  240
TRACLGVVEL VMTTQKINYN AEIENICSAL KEVDLRSTDG SSDPFAKQTC YTLRAVSLKE  300
LVDEGSIETN LPTQQEFYDN SVHENLGELC SGVDVPARTT SLENSEEVSS WIASLVDAQH  360
KGVKEIDGDL PFGFTKHEDE GFSVTAGWNT SPVLGPEDSI FSGFKHHEEY EVKEANCSSP  420
PNTSNLEKTV EKRRTKTEKT VSLEDLRKHF AGSLKEAAKN LRVCPTTLKR ICRQHGINRW  480
PSRKIKKVGH SLKKLQMPSW GFDKLKEEIL RRFSIAKENY VDLKYLDDES EWVLLTCDAD  540
LLECIDVYKS SSAQT
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025797092.11e-140protein NLP1-like
SwissprotQ10S831e-134NLP1_ORYSJ; Protein NLP1
TrEMBLA0A3L6TQF21e-140A0A3L6TQF2_PANMI; Protein NLP1-like isoform X2
STRINGSb01g048290.11e-139(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP110253241
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]