PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc00094.1.g00250.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family bZIP
Protein Properties Length: 109aa    MW: 11846.5 Da    PI: 12.1729
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc00094.1.g00250.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_124.84.7e-084372534
                                  CHHHCHHHHHHHHHHHHHHHHHHHHHHHHH CS
                        bZIP_1  5 krerrkqkNReAArrsRqRKkaeieeLeek 34
                                  +r rr+ +NRe+Arr+R+ K+ ++ eL  +
  Zmw_sc00094.1.g00250.1.am.mk 43 RRLRRRVSNRESARRCRAWKQLRLHELPAR 72
                                  799**********************99765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1704.0E-63671No hitNo description
SuperFamilySSF579597.09E-54374No hitNo description
Sequence ? help Back to Top
Protein Sequence    Length: 109 aa     Download sequence    Send to blast
MALQHIGSGI AIVSCPAPLP IQHPVATSPD VDAAKADSSV DERRLRRRVS NRESARRCRA  60
WKQLRLHELP ARRGRLPDPA PRGCSPSANA APTVRGHDGG RQRPRPRAG
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP2274346