PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc00078.1.g00210.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family bZIP
Protein Properties Length: 339aa    MW: 35390.1 Da    PI: 8.0229
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc00078.1.g00210.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_141.13.8e-13279322548
                                   CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                        bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkke 48 
                                   +r+rr++kNRe+A rsR+RK+a++ eLe +v+ L++ N +L+k+
  Zmw_sc00078.1.g00210.1.sm.mk 279 RRQRRMIKNRESAARSRARKQAYTMELEAEVQMLKEINAELQKK 322
                                   79*************************************99875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003383.8E-13275339IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.496277322IPR004827Basic-leucine zipper domain
CDDcd147072.83E-26279333No hitNo description
SuperFamilySSF579593.19E-11279323No hitNo description
Gene3DG3DSA:1.20.5.1701.8E-14279322No hitNo description
PfamPF001702.9E-11279322IPR004827Basic-leucine zipper domain
PROSITE patternPS000360282297IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009737Biological Processresponse to abscisic acid
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 339 aa     Download sequence    Send to blast
MDPKDGERRG PPARQGSIYS LTFDEFQSTL GGMAGGGLGK DFGSMNMDEL LRSIWTAEES  60
QAMASASGSG TAALGAGDDG ALQRQGSLTL PRTLSVKTRQ GSLTLPRTLS VKTVDEVWRD  120
FAREGAPSAG GCGGEPQPSR QPTLGEMTLE EFLVRAGVVR ENPAAAGFPA PIQAVNNGSS  180
IFFGNFGGAA SDTGAGAMGF APVGIGNPSA MGNGLMPGMA GMGGAAVTVS PVDTSVAQLD  240
SVGKGNSDLS SPMAPLPCPF EGVIRGRRSG AGVEKVVERR QRRMIKNRES AARSRARKQA  300
YTMELEAEVQ MLKEINAELQ KKQCVFLLAV YLARVFPDV
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that mediates abscisic acid (ABA) signaling. Binds specifically to the ABA-responsive element (ABRE) of the EMP1 and RAB16A gene promoters. {ECO:0000269|PubMed:10611387}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00087SELEXTransfer from AT1G49720Download
Motif logo
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By abscisic acid (ABA). {ECO:0000269|PubMed:10611387}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004973666.11e-141bZIP transcription factor TRAB1
SwissprotQ6ZDF31e-119TRAB1_ORYSJ; bZIP transcription factor TRAB1
TrEMBLK3YI351e-141K3YI35_SETIT; Uncharacterized protein
STRINGSi013904m1e-141(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP70638147
Publications ? help Back to Top
  1. Kagaya Y,Hobo T,Murata M,Ban A,Hattori T
    Abscisic acid-induced transcription is mediated by phosphorylation of an abscisic acid response element binding factor, TRAB1.
    Plant Cell, 2002. 14(12): p. 3177-89
    [PMID:12468735]
  2. Kobayashi Y, et al.
    Abscisic acid-activated SNRK2 protein kinases function in the gene-regulation pathway of ABA signal transduction by phosphorylating ABA response element-binding factors.
    Plant J., 2005. 44(6): p. 939-49
    [PMID:16359387]
  3. Kobayashi F,Maeta E,Terashima A,Takumi S
    Positive role of a wheat HvABI5 ortholog in abiotic stress response of seedlings.
    Physiol Plant, 2008. 134(1): p. 74-86
    [PMID:18433415]