PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc00076.1.g00070.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family SBP
Protein Properties Length: 304aa    MW: 32787.7 Da    PI: 10.336
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc00076.1.g00070.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP131.13.8e-4176151277
                                   -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
                           SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                                   C v++C+adls++++yhrrhkvCe+hsk+pvv+v g+e+rfCqqCsrfh+lsefDe+krsCr+rL++hn+rrrk+q
  Zmw_sc00076.1.g00070.1.sm.mk  76 CSVDRCRADLSRCRDYHRRHKVCEAHSKTPVVVVGGQEKRFCQQCSRFHMLSEFDEGKRSCRKRLDGHNRRRRKPQ 151
                                   **************************************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.102.1E-3370137IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.92373150IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.18E-3875155IPR004333Transcription factor, SBP-box
PfamPF031106.6E-3076149IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 304 aa     Download sequence    Send to blast
MNRAAVTSEA SSWGAAADRG PIMLSFAGPS SSTSPAAEIQ FQDFSVGLVR RAQPPGSSGA  60
RRRSRGASGG GVPEACSVDR CRADLSRCRD YHRRHKVCEA HSKTPVVVVG GQEKRFCQQC  120
SRFHMLSEFD EGKRSCRKRL DGHNRRRRKP QLNQFAIHPQ LATRSGQNSN SMRLIDGQQA  180
FSISFAGTFK APKQFPFSQE GGSILNEFHP NNLLARNDSH TRSSGLSGML GPEYALSLLS  240
SSLHRPSPAA GPAQVTSPLA CFIATSQDAT TAAAVGYASG AAHHTFAPDA MFEDPSQALP  300
FIWQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-2966149184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1132149KRSCRKRLDGHNRRRRKP
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3'. {ECO:0000250}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002450775.11e-108putative squamosa promoter-binding-like protein 19 isoform X1
RefseqXP_021317606.11e-108putative squamosa promoter-binding-like protein 19 isoform X1
RefseqXP_021317607.11e-108putative squamosa promoter-binding-like protein 19 isoform X1
SwissprotQ2R3Y16e-77SPL19_ORYSJ; Putative squamosa promoter-binding-like protein 19
TrEMBLC5Y2L51e-106C5Y2L5_SORBI; Uncharacterized protein
STRINGSb05g017510.11e-107(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP129612532