PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc00073.1.g00330.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family bZIP
Protein Properties Length: 353aa    MW: 39170.6 Da    PI: 9.9543
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc00073.1.g00330.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_121.55.1e-072232591753
                                     HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                          bZIP_1  17 ArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelk 53 
                                     A+rsR RK+++i+eLe+kv++L++e  +   e+e l+
  Zmw_sc00073.1.g00330.1.sm.mkhc 223 AQRSRVRKLQYIAELERKVQALQSEGIEVSAEMEFLT 259
                                     899*********************9777666666665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003388.5E-6212271IPR004827Basic-leucine zipper domain
CDDcd147031.21E-15213263No hitNo description
SuperFamilySSF579592.88E-6222265No hitNo description
Gene3DG3DSA:1.20.5.1706.0E-9223265No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 353 aa     Download sequence    Send to blast
MMANGKLQKQ ALLPPRSPFP TAAAAPYADR SWIARTQGAP HHRHGHSHHQ RTSSESFIEE  60
QPSWLEDLLN EPETPVRQHG RAGHRRSSSD SFALFDGGAA GAGACASGFE AVSRGGGKVA  120
ARGGVQEYYA KPGLFGRPQG RSWEQGMPNL GGYRHGNGPP MPMKEKPGGH HGPPSAFRNH  180
DYGMDNRAPD DAGHDQKVGL KEGVPPKHAQ LEADTKRAKQ QYAQRSRVRK LQYIAELERK  240
VQALQSEGIE VSAEMEFLTQ QNIMLDLENK ALKQRLESLT QEQRIKRFQQ EMFEREIGHL  300
RSLYQQQQQQ LSQAPALGRS NSSDLDSQFA NLSLKYNKDP NSGRDSLSGS LRT
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025828158.10.0uncharacterized protein At4g06598-like
RefseqXP_025828159.10.0uncharacterized protein At4g06598-like
TrEMBLA0A0A9E2N80.0A0A0A9E2N8_ARUDO; Uncharacterized protein
STRINGPavir.Hb01242.1.p1e-175(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP33103666