PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc00067.1.g00200.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family ZF-HD
Protein Properties Length: 390aa    MW: 40986.3 Da    PI: 6.8267
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc00067.1.g00200.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer105.24e-33189244359
                   ZF-HD_dimer   3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrevee 59 
                                    v+Y+eClkNhAa++Gg+a+DGCgEfmps geeg+ +alkCaACgCHRnFHR+ev++
  Zmw_sc00067.1.g00200.1.am.mk 189 VVKYRECLKNHAAAMGGNATDGCGEFMPS-GEEGSLEALKCAACGCHRNFHRKEVDD 244
                                   589*************************9.999*********************876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF047706.5E-30190242IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
ProDomPD1257747.0E-24191243IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015668.7E-31191242IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152328.086192241IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
SuperFamilySSF466891.44E-17289359IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.0E-27291360IPR009057Homeodomain-like
TIGRFAMsTIGR015658.4E-26300356IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 390 aa     Download sequence    Send to blast
MLAPMAEAAE PGYLAPRPCF FVLTQQHGSS SSMFLCVWSQ ERRAKNRRGS MDLSGNQGEL  60
PIPMQAPASP NASGLVLLPS PPAAATEELG NNNNGTEALV LLPSPPAAAM EEEYGNNKNG  120
NEAAPVLLPS PPAAATEEEQ GNNNNGNEAP VLLPSPPAAA ATEEEESSGL KKPAAVSVTG  180
AIGTGAGPVV KYRECLKNHA AAMGGNATDG CGEFMPSGEE GSLEALKCAA CGCHRNFHRK  240
EVDDDAGHGN GCSYGHRFTD PYAAMHAPPP LHHHQLVNAV PLSAVHTAEP GARGSASSMK  300
RFRTKFSAEQ KARMLAFAER AGWRLTNVDE GAVQAFCQEI GVRRPVLKVW MHNNKYTLRS  360
KRLQAPPVAA AAAPLSPPPP PLLCLSHQAV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A4e-232983551673ZF-HD homeobox family protein
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00258DAPTransfer from AT2G02540Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002449277.15e-68hypothetical protein SORBIDRAFT_05g007050
TrEMBLC5Y7T96e-68C5Y7T9_SORBI; Putative uncharacterized protein Sb05g007050
STRINGSb05g007050.12e-67(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP81535145