PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc00055.1.g00510.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family LBD
Protein Properties Length: 444aa    MW: 48893.7 Da    PI: 9.7065
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc00055.1.g00510.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26060.44.8e-1953120269
                        DUF260   2 CaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAeara 69 
                                   CaaC ++r kC+++Cv+apyf +e+ ++fa+++  FGasnv+k++++ ++ er  a++ l+y A  ra
  Zmw_sc00055.1.g00510.1.sm.mk  53 CAACTHMRLKCEPGCVFAPYFGSEDGEQFAVLEGAFGASNVSKVVAEHEPGERAVAIKRLLYLATERA 120
                                   ****************************************************************9886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089112.86651152IPR004883Lateral organ boundaries, LOB
PfamPF031954.1E-1753120IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 444 aa     Download sequence    Send to blast
MDPKVPNCSR PCGAATDPSS PLSPSPSPSS MIAGVSSDAV VASSSEGERE KVCAACTHMR  60
LKCEPGCVFA PYFGSEDGEQ FAVLEGAFGA SNVSKVVAEH EPGERAVAIK RLLYLATERA  120
WGSSVPRGHA EKLPIQRARQ LTAAQQAAAT AQASREQALM MQYHAGTGFG VPVAHLPSYH  180
YQAMIARRHD MMMRQAAAAQ NYQAFGLEQQ RQGAAAKRKS MPQPVAELQR RRAAANEVLM  240
MQYHAGKEFG VPVGRLPSHQ ATEIERQQTA AAAVARHRDM KMRQAAVAMV YQALGLQRPR  300
QNQQLAEDVT HQNRHTALTA EAAKRSTAAD AAMVREIDKI LQFLRQAAVE EQYMNRCLSI  360
MMQQTVVDGQ QEHHHLGQDR AGKNAVIRRN IMKGIANRQY IDQNIKRVQQ YWEKELMMMM  420
EKAAANAPAM PGEQPQPQRQ TGNH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A8e-14531191278LOB family transfactor Ramosa2.1
5ly0_B8e-14531191278LOB family transfactor Ramosa2.1
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP3628134