PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc00055.1.g00500.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family LBD
Protein Properties Length: 760aa    MW: 83778.3 Da    PI: 4.2899
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc00055.1.g00500.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26055.12.3e-1772132262
                        DUF260   2 CaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslv 62 
                                   C aCk++rrkC++dCv+apyf  e++++fa++ +  Gasnv k+l +++++er +a++  v
  Zmw_sc00055.1.g00500.1.am.mk  72 CVACKHMRRKCEPDCVFAPYFGPEDEERFAVMDRGIGASNVAKMLGRIDPQERAHAIDMFV 132
                                   *****************************************************99987554 PP

2DUF26058.51.9e-18223292271
                        DUF260   2 CaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearard 71 
                                   CaaC+ +rrkC++dCv+ p f  e+ ++f +v ++FGa+ v+ +l++l ++er +a++ lv +A   +r+
  Zmw_sc00055.1.g00500.1.am.mk 223 CAACRQMRRKCVPDCVFVPFFGPEDGERFYAVDRIFGAHYVSDMLEDLAPHERWNAVEMLVHQATLGMRN 292
                                   ****************************************************************987776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089113.370171IPR004883Lateral organ boundaries, LOB
PfamPF031951.0E-1672135IPR004883Lateral organ boundaries, LOB
PROSITE profilePS5089115.453221322IPR004883Lateral organ boundaries, LOB
PfamPF031951.1E-17223294IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 760 aa     Download sequence    Send to blast
MPRRRRRPLP SSLPAPSPSS STTCGKQPLL PACSFRFERM HELTNRSSMS EATRPSEEVS  60
AAPELEPQSQ DCVACKHMRR KCEPDCVFAP YFGPEDEERF AVMDRGIGAS NVAKMLGRID  120
PQERAHAIDM FVAAAIQGMP AERPPWTVSL EEQQLAAFLV ERPQNRPPRT LIMLEQARHE  180
NQQMAEAANS NVLSGRQNQH SSTVCAMSSS SVAPETEPQS QDCAACRQMR RKCVPDCVFV  240
PFFGPEDGER FYAVDRIFGA HYVSDMLEDL APHERWNAVE MLVHQATLGM RNQQMAEVQQ  300
PQRADGRVYG NQQTVPQVAG SQNSAAVDQD QLRMKMMAQV RRNAAAARKA FFPQLAQLQQ  360
MRAAAEVAEV AMNPDMMMWQ ATAAPTQQMY QAEAQQLPAS TLGGATQRDM MMQQATAAAA  420
VQNYPYSVQQ YPEMGLEQQH QQNQQMAQAA NLATAAEAAM DQEMLEYLMM PAPSPAAAAA  480
TEQSNYQLGQ QQLPEPEKEH ALELPAADEF GWDEDLMTRQ FTEAVATAGV TTDEYLMMTT  540
TMVELQDVAG GQQNGHDHTE LYANMGQGHQ LGQQLSDPET EHALEVPAAD EFGWDEDLMT  600
RQMVEAAATA GVTADEYLMM TATMVELQDV AGGQQNGHDH AEQYANMGHG HQLGQQLPDP  660
ESTEQALELP AADEFGWDED LMTRQMAEAA ATAGVTADEY LMMTTTTLEL MDVPGGQQDG  720
HDHAERYANM GRGNTDLQRN GGGAEVQSPD VAAYFTNDDM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A6e-1761286175LOB family transfactor Ramosa2.1
5ly0_B6e-1761286175LOB family transfactor Ramosa2.1
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
117PRRRRRP
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP3628234