PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc00044.1.g00840.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family bZIP
Protein Properties Length: 1162aa    MW: 127175 Da    PI: 11.6743
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc00044.1.g00840.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_128.53.2e-0910211079563
                                    CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                        bZIP_1    5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63  
                                    kr +r   NR +A rs +R+  +i+eLe+kv+ L++e ++L  +l  l+  +a l +++
  Zmw_sc00044.1.g00840.1.am.mk 1021 KRVKRVLANRQSAARSKERRMRYIAELEQKVQILQTEATTLSAQLTLLQRDSAGLATQN 1079
                                    899*********************************************99998887766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003383.7E-1610171081IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.69110191082IPR004827Basic-leucine zipper domain
SuperFamilySSF579594.64E-1010211072No hitNo description
PfamPF001701.3E-810211079IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1705.2E-1010211078No hitNo description
CDDcd147039.99E-2210221073No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1162 aa     Download sequence    Send to blast
MIKTDAAYFN RRVIEQRKAA SWSRLIAPPV DHHLSPCIML RSARDGGSGG TAPCMHALQF  60
SEVGRRSRRR GADVDVYTSR RRRCGHVRLP VPRRIHRRLA GAFQMLARGS LPGVRPAHVG  120
PIARPPPSPG GRRACDRPAK AGKRSSRSIA RGTSSFCSPL YSLMTNGSPF HRCPFRSVRK  180
ERRVISTKSV WKKKKKILGV SGKKVEGPAG RLQLVAHTPY HVTLGQAEPA FLSGDGVPTL  240
RRSFAAAHDA LGCRDSRPAN RCQPKPHGSR LGRARARGSP IELDRCVRGL ITCRMIAPRS  300
GPCRHHGFGS SIGARPPHVR AVQSPPSHRA SWRWIRMIWL ASSMARPARS GDDRLLRPEG  360
SSSGVVPIRF GRRARAEGQH AMWFASMATG DLSTDPATAE RRERQAPRRD SLIDRSESPS  420
RGHVGVPAPV RRVVVLDFMT TADLTVRRAY VRAPPAPVEP SHPLTLTETP RKRVAHCERT  480
SRASVPVPPG RITNGLWRGR SSLRTPAGSG IDLAVRRPRL DPWQRLPPPF AATFVRCAVS  540
HPVVRGDDVS RTRSGNLKVC LRCTQFGHGR RACRARKLST RTPVRGAALL RPMGERVNKL  600
EYYAPFVPKE VAYSSLFQPQ YYTPHLPFRH PLVSCRFGFL TVSNRSALHF TISLSRSPID  660
RRAFRKRDDS AAAAAREGTE ERSANSASAT WVMGSPVAVR DPQQGLLMAK LSNDRSIVDD  720
QDEHFRCKKQ RHLISAVRSM QRDRPNGTTF PRASRPKMMR RLPARGGTED DAAAAGARRS  780
SLARARKRNT VPASEMNGAA NGHGLVPHHH HHHPAQASAP FAAQHQGSGG GRQLAGLPPT  840
PPGSHAAHAD VCMXXXXPPS PKTEASGGGW GLPVSGGGGD DLFNAYMSMD GVDAGLRYGS  900
DADSLGSSMR TNGADSSENE SEDYGGGADS QFLVWGDAAG KKSREGGKRN GAREPAAAPA  960
GRGHARSLSM DSLIGKLSFS ANGEPGGKFS LDFGGGEFTP AEMKRIMADE KLAEMALADP  1020
KRVKRVLANR QSAARSKERR MRYIAELEQK VQILQTEATT LSAQLTLLQR DSAGLATQNN  1080
ELKFRLQAME QQAQLRDALN EALTAEVQRL KVGDASSSSN LPQQMQLHCQ SQMQELHKQQ  1140
QGEQIPFYQL EQREVARNHE AK
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
16782RRRGADVDVYTSRRRR
2191203KKKKKILGVSGKK
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP35363576