PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc00043.1.g00160.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family NAC
Protein Properties Length: 75aa    MW: 8225.72 Da    PI: 9.0051
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc00043.1.g00160.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM42.12.7e-1353599129
                           NAM  99 lvglkktLvfykgrapkgektdWvmheyrle 129
                                   +vg+kktLvfy gr+p gekt+W+mheyrle
  Zmw_sc00043.1.g00160.1.sm.mk   5 VVGMKKTLVFYIGRSPWGEKTEWIMHEYRLE 35 
                                   69***************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100516.842162IPR003441NAC domain
SuperFamilySSF1019411.44E-13440IPR003441NAC domain
PfamPF023657.1E-7634IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 75 aa     Download sequence    Send to blast
MMPAVVGMKK TLVFYIGRSP WGEKTEWIMH EYRLEGSGKF CCPSSSSNIS KAAMTLCCGN  60
MQALAKHTMH GPVAT
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_022679478.11e-15protein CUP-SHAPED COTYLEDON 1
RefseqXP_025801540.17e-16NAC domain-containing protein 79-like
TrEMBLA0A1E5V4C45e-16A0A1E5V4C4_9POAL; NAC domain-containing protein 79
STRINGSi030284m5e-15(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP3620734