PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc00043.1.g00150.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family NAC
Protein Properties Length: 62aa    MW: 6860.57 Da    PI: 3.8223
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc00043.1.g00150.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM37.38.4e-122062144
                           NAM  1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykveP 44
                                  lp Gf FhP+dee++++yL +k+ ++++++ ++i+++di+++eP
  Zmw_sc00043.1.g00150.1.sm.mk 20 LPLGFGFHPSDEEIITFYLMPKMLDSNFTA-DAIADADINNSEP 62
                                  699*************************99.99*********99 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.53E-141762IPR003441NAC domain
PROSITE profilePS5100515.9422062IPR003441NAC domain
PfamPF023653.3E-52145IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 62 aa     Download sequence    Send to blast
MEDHKYEGIR GTVDDAGLNL PLGFGFHPSD EEIITFYLMP KMLDSNFTAD AIADADINNS  60
EP
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_023769928.11e-14NAC domain-containing protein 87-like
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP4092033