PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc00034.1.g00550.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family ZF-HD
Protein Properties Length: 489aa    MW: 53620.9 Da    PI: 10.1914
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc00034.1.g00550.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer889.2e-28312367258
                   ZF-HD_dimer   2 ekvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreve 58 
                                   ++vrY eC++NhAas+Gg+++DGC+Ef+++ geegt  +lkCaACgCHR+FHRr ++
  Zmw_sc00034.1.g00550.1.am.mk 312 CSVRYGECRRNHAASTGGYSIDGCREFIAE-GEEGTGGGLKCAACGCHRSFHRRVQV 367
                                   789**************************8.999********************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257742.0E-17304369IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047704.8E-27314366IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015662.7E-20315364IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152324.255316365IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Sequence ? help Back to Top
Protein Sequence    Length: 489 aa     Download sequence    Send to blast
MEQIKTSGGR VSGSCVRKLM ARRREKSASG GGGDIREQHH VGEPRRRLGA LLLASNAGGL  60
YRERNQLQEA EATLESSTTL GSRAVASAPF CLHPTRAGST GMQLVELTQV GGRHEECDEV  120
DAQHALAAFF FYLPAGSPLF FFLDHQLPPS TLLSLSPPLS PEGAVPCGGE GEELLQWWRW  180
LGTSRRQGSG VGDNALCAAA VPEVARRSYC GAGVVGCRHS TAVSSGRRRA EKGGKVGARA  240
RHGDDDGGVR PVRGEKASRR AGQASPVSFS GLRRRRRRRR RFVSPGRPFP EARPTLHFTW  300
RWCEPIVRFT CCSVRYGECR RNHAASTGGY SIDGCREFIA EGEEGTGGGL KCAACGCHRS  360
FHRRVQVFEA LELDPRKQFV TSRVPCTRLD PQYMCRRSVI QRILFTLESR ITCDGAPGLG  420
ERTTRAEISS RRRAILPGEL NELQCTTARA PELTLVSEQQ LWELMARTGN GSGLVLNAAA  480
SWWIRWKVV
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1272280RRRRRRRRR
2273280RRRRRRRR
3274280RRRRRRR
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP143134120