PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc00026.1.g00550.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family LBD
Protein Properties Length: 185aa    MW: 20709.4 Da    PI: 5.7006
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc00026.1.g00550.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26058.42.1e-182484262
                        DUF260  2 CaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslv 62
                                  C aCk++rrkC++dCv+apyf  e++++fa++ +  Gasnv k+l +++++er +a++  v
  Zmw_sc00026.1.g00550.1.sm.mk 24 CVACKHMRRKCEPDCVFAPYFGPEDEERFAVMDRGIGASNVAKMLGRIDPQERAHAIDMFV 84
                                  *****************************************************99987554 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089113.322123IPR004883Lateral organ boundaries, LOB
PfamPF031959.2E-182487IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 185 aa     Download sequence    Send to blast
MSEATRPSEE VSAAPESEPQ SQDCVACKHM RRKCEPDCVF APYFGPEDEE RFAVMDRGIG  60
ASNVAKMLGR IDPQERAHAI DMFVAAAIQG MPAERPPWTV SLEEQQLAAF LVERPQNRPP  120
RTLIMLEQAR HENQQMAEAA NSNVLSGRQN QHSSTVCGEQ PRLAALVRIR TTRSLLITDR  180
SYYIS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A1e-161381169LOB family transfactor Ramosa2.1
5ly0_B1e-161381169LOB family transfactor Ramosa2.1
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP4745533