PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc00026.1.g00540.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family LBD
Protein Properties Length: 539aa    MW: 59240.7 Da    PI: 4.0875
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc00026.1.g00540.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260552.3e-171786271
                        DUF260  2 CaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearard 71
                                  CaaC+ +rrkC++dCv+ p f  e+ ++f +v ++F a+ v+ +l++l ++er +a++ lv +A   +r+
  Zmw_sc00026.1.g00540.1.sm.mk 17 CAACRQMRRKCVPDCVFVPFFGPEDGERFYAVDRIFCARYVSDMLEDLAPHERWNAVEMLVHQATLGMRN 86
                                  ****************************************************************987766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089114.45215116IPR004883Lateral organ boundaries, LOB
PfamPF031952.1E-161787IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 539 aa     Download sequence    Send to blast
MSSSSAAPET EPQSQDCAAC RQMRRKCVPD CVFVPFFGPE DGERFYAVDR IFCARYVSDM  60
LEDLAPHERW NAVEMLVHQA TLGMRNQQMA EAQQPQRADG RVYGNQQTVP QVAGSQNSAA  120
VDQDQLRMKM MAQVRRNAAA ARKAFFPQLA QLQQMRAAAE VAMNPDMMMW QATAAPTQQM  180
YQAEAQQLPA STLGCATQRD MMMQQATAAA AAQNYPYSVQ QYPEMGLEQQ HQQNQQMAEA  240
ANLATAAEAA MDQEILEYLM MPAPSPAAAA ATEQSNYQLG QQQLPEPEKE HALELPAADE  300
FGWDEDLMTR QFTEAAAPAG VTTDEYLMMT TTMVELQDVA GGQQNGHDHT ELYANMGQGH  360
QLGQQLPDPE TEHALEVPAA DEFGWDEDLM TRQMVEAAAT AGVTADEYLM MTATMVELQD  420
VAGGQQNGHD HAEQYANMGH GHQLGQQLPD PESTEQALEL RAADEFGWDE DLMTRQMAEA  480
AATAGVTADE YLMMTTTTLE LMDVPGGQQN GHDHAERYAN MGRGNTDLQR NGGGAVVQH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A2e-16680175LOB family transfactor Ramosa2.1
5ly0_B2e-16680175LOB family transfactor Ramosa2.1
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP3628234