PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc00026.1.g00530.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family LBD
Protein Properties Length: 444aa    MW: 48797.5 Da    PI: 9.8024
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc00026.1.g00530.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26061.91.7e-1953120269
                        DUF260   2 CaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAeara 69 
                                   CaaC +lr kC+++Cv+apyf +e+ k+fa+++  FGasnv+k++++ ++ er  a++ l+y A  r+
  Zmw_sc00026.1.g00530.1.sm.mk  53 CAACTHLRLKCEPGCVFAPYFGSEDGKRFAVLEGAFGASNVSKVVAEHEPGERAVAIKRLLYLATERV 120
                                   ****************************************************************9886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089112.78151152IPR004883Lateral organ boundaries, LOB
PfamPF031951.9E-1753120IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 444 aa     Download sequence    Send to blast
MDPKVPNCSR PCGAATEPSS PLSPSPSPSS TIAGVSSDAV VASSSEGERE KVCAACTHLR  60
LKCEPGCVFA PYFGSEDGKR FAVLEGAFGA SNVSKVVAEH EPGERAVAIK RLLYLATERV  120
WGSSVPRGHA EKLPIQRARQ LTAAQQAAAT AQASREQALM MQYHAGTGFG VPAAHLPSYH  180
YQAVIARHHD MMMRQAAAAQ NYQAFGLEQQ RQGAAAKRKS MPQPVAELQR RRAAANEVLM  240
MQYHAGKEFG VPAGHLPSHQ ATEIERQQTA AAAVARHRDM KMRQAAVAMV YQALGLQRPR  300
QNQQLAEGVT HQNHHTALTA EAAKRSTAAD AAMVREIDKI LRFLRQAAVE EQYMNRCLSI  360
MMQQTVVDGQ QEHHHLGQDR EGKNAVIRRN IMKGIANRQY IDQNIKRVQQ YWEKELMMMM  420
EKAAANAPAM PGEQPQPQRQ TGNH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A1e-14531201279LOB family transfactor Ramosa2.1
5ly0_B1e-14531201279LOB family transfactor Ramosa2.1
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP3628134