PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc00026.1.g00500.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family LBD
Protein Properties Length: 759aa    MW: 83272.8 Da    PI: 7.723
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc00026.1.g00500.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26051.52.9e-1678148272
                        DUF260   2 CaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardP 72 
                                   C aC+++rrkC++dCv+ap+f  ++ ++f ++ + FGas v++ l++ ++ er +a++ lv  A a +  P
  Zmw_sc00026.1.g00500.1.am.mk  78 CVACRHMRRKCEPDCVFAPHFGPDDGERFGALDRAFGASFVSQQLADREPRERAAAIEMLVRIAIASVPRP 148
                                   9********************************************************99998887777666 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089112.6376176IPR004883Lateral organ boundaries, LOB
PfamPF031954.8E-1578148IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 759 aa     Download sequence    Send to blast
LIDCRAAASD PSSLSPSPRR RSSSTAGGKQ PLLAAGSFGF ERARMRSVCF VSFRSLLTPN  60
RCSISDAMAS SEEAEKVCVA CRHMRRKCEP DCVFAPHFGP DDGERFGALD RAFGASFVSQ  120
QLADREPRER AAAIEMLVRI AIASVPRPAG VKAQQEAAAA QISREQALIR QYHTGTGFGV  180
PAYQSAEYQA MIASHQEMLM RNAGAVYQPL ELEELLQGAA AKQKSTLQPV AELQQQRTAA  240
EEVARHHDMV MRQAAAAQNY QALGLEQQRE GAAAKQKSIL QPVAELQQQR TAADVVARYH  300
DMVMRQAAAA VQNYQALGLE QQREGAAAKQ KSMLQPVAEL QQQRTAADVV ARYHDMVMRQ  360
AAAAVQNYQA LGLEQQREGA AAKQKSMLQP VAELQQQRTA AGEVARYHDM MMRQAAAAAA  420
AVQNYQALGL EQQRESAAAK QKSMLQPVAE LQQERTAADE VARHHAMMMR QAAAAQNYLG  480
IEQQREGAAA KQKSMLQPVA ELQQQRTAAE EVTRHHDKMM QQAAAAQNYQ ALGLEQQHQN  540
RQLAEGVMHQ TELTAEAAKR ATAEEAAGVR EVDMVLQSLR QAAVEEQYMD NYLRAVMLET  600
VADGQQQQHP LHHDQAGQNA AMLQQKLAQG IVNTQKIDQQ IAIAQQHWEK KLTTMQQAAA  660
NVPAMRGEQP QPQRQTRNAQ FQKESSLPPL PTQPRHAGGA SGARTMPFLP GRSADSEAFL  720
VQPSLPSLPP SLADTPRQQQ NDGGNEDLSV DPTLRLWNH
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP3626534