PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc00014.1.g00210.1
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family LBD
Protein Properties Length: 295aa    MW: 31480.1 Da    PI: 7.2299
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
                        DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvil 81 
                                   +CaaCk+lrrkC+++Cv+apyfp ++p+kfanvh++FGasnv+kll++lp+ +reda++sl+yeA+ar+rdPvyG+v+ i+   6 PCAACKLLRRKCTQGCVFAPYFPPDNPAKFANVHRVFGASNVSKLLHDLPHAQREDAVNSLAYEADARLRDPVYGCVSYIS 86 
                                   7******************************************************************************** PP

                        DUF260  82 klqqqleqlkaelallkee 100
                                    lq +++q++ ela++++e  87 VLQLRIRQARDELAAARKE 105
                                   **************99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.3045106IPR004883Lateral organ boundaries, LOB
PfamPF031951.9E-416103IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009954Biological Processproximal/distal pattern formation
GO:0009965Biological Processleaf morphogenesis
GO:0048441Biological Processpetal development
Sequence ? help Back to Top
Protein Sequence    Length: 295 aa     Download sequence    Send to blast
3D Structure ? help Back to Top
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A7e-4731098114LOB family transfactor Ramosa2.1
5ly0_B7e-4731098114LOB family transfactor Ramosa2.1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012704292.11e-116LOB domain-containing protein 6
TrEMBLA0A1E5VYJ41e-119A0A1E5VYJ4_9POAL; LOB domain-containing protein 36
STRINGSi036905m1e-116(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number