PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zosma9g00620.1
Common NameZOSMA_9G00620
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Zosteraceae; Zostera
Family CPP
Protein Properties Length: 789aa    MW: 86293.2 Da    PI: 7.3258
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zosma9g00620.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR50.93e-16468508242
             TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkeek 42 
                     ++++CnCkkskClk+YCeCfaag++C e C+C++C Nk e+
  Zosma9g00620.1 468 SCRRCNCKKSKCLKLYCECFAAGVYCVEPCSCQGCLNKPEH 508
                     6899*********************************9876 PP

2TCR50.25e-16553592140
             TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                     ++k+gCnCkks+ClkkYCeC++ g+ Cs +C+Ce+CkN+ 
  Zosma9g00620.1 553 RHKRGCNCKKSSCLKKYCECYQGGAGCSISCRCEGCKNTF 592
                     589***********************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011144.6E-16467508IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163436.392468593IPR005172CRC domain
PfamPF036389.6E-12470505IPR005172CRC domain
SMARTSM011146.3E-17553594IPR033467Tesmin/TSO1-like CXC domain
PfamPF036382.4E-11555591IPR005172CRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009934Biological Processregulation of meristem structural organization
GO:0048444Biological Processfloral organ morphogenesis
GO:0051302Biological Processregulation of cell division
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 789 aa     Download sequence    Send to blast
MDTPKRNGDG DCGKQQQSRT PMGSRVEDSP VFIYINNLSP MKPVKPVHIA QTIHSLSLPP  60
VSSIFTTPHI ATKESRFLTR SPLLSLPKPD FSDLCRSEIT NTANLPDNPD SKLSQSLNET  120
DINPTEECST RPSTQPEPFH YDCGSPYHTN SPCHDINSDT KCVMGRTSSI DFAHEDLVEK  180
IIDQSLPGFE IQSSDNDIGQ PKEVQALDWE TDTYVEEGDD LLFFNSSNLD ASVGPFHSYI  240
DHSSNVDLAT SLSQSSNDNI PTTQEENSSL RYFHVNEKID DKASENINNL FNDQGDIQQQ  300
RCMPRRCLTF DMAGVRRKSF GFREDSKTSS SLPHNSKQQT TSSTPGISRI SLHLNSAKQT  360
ASSTPGIPRI GLHLNSVASI PLDRFVQDVL PSASQHSVNM SSSIISSGNM QNKLHNSMSA  420
EKSQESDVQG LLIVQDCDTL PSDVGKSDDL SHSSPKNKKR RSETEGDSCR RCNCKKSKCL  480
KLYCECFAAG VYCVEPCSCQ GCLNKPEHKD TVLATRKQIE SRNPLAFAPK VIRSSEPVLE  540
IGEETNKTPA SARHKRGCNC KKSSCLKKYC ECYQGGAGCS ISCRCEGCKN TFGRKDGTMP  600
KGNLEADSKG GTEQQTHCSE VEKIDNHHNA TVNCNQQPIY ENLPITPFQS CRSSIQHPFT  660
SKGKPPRSSL AIGGSSSTTS KAIVKFEGPS TSYFHLLADN EIPKNLLSDG SPSSGVKVIS  720
PSKRRISPPL IEGVGGRVSP SRKGCRKFTL KSKSISSFPS LTCDSTDEYN LTKSSSPSTS  780
TAFNSQHL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A3e-1747259014120Protein lin-54 homolog
5fd3_B3e-1747259014120Protein lin-54 homolog
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1454460PKNKKRR
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00624PBMTransfer from PK22848.1Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A0K9NGS10.0A0A0K9NGS1_ZOSMR; Tesmin/TSO1-like CXC domain-containing protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP61473447
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G22780.15e-93Tesmin/TSO1-like CXC domain-containing protein